Advertisement
Research ArticleNeuroscience Free access | 10.1172/JCI82409
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Xu, W. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Weissmiller, A. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by White, J. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Fang, F. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Wang, X. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Wu, Y. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Pearn, M. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Zhao, X. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by
Sawa, M.
in:
PubMed
|
Google Scholar
|
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Chen, S. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Gunawardena, S. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Ding, J. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Mobley, W. in: PubMed | Google Scholar
1Department of Neurology and Institute of Neurology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, China.
2Department of Neurosciences, UCSD, La Jolla, California, USA.
3Department of Biological Sciences, The State University of New York at Buffalo, Buffalo, New York, USA.
4Department of Anesthesiology, UCSD, La Jolla, California, USA.
5VA San Diego Healthcare System, San Diego, California, USA.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Find articles by Wu, C. in: PubMed | Google Scholar
Published April 11, 2016 - More info
The endosome/lysosome pathway is disrupted early in the course of both Alzheimer’s disease (AD) and Down syndrome (DS); however, it is not clear how dysfunction in this pathway influences the development of these diseases. Herein, we explored the cellular and molecular mechanisms by which endosomal dysfunction contributes to the pathogenesis of AD and DS. We determined that full-length amyloid precursor protein (APP) and its β-C-terminal fragment (β-CTF) act though increased activation of Rab5 to cause enlargement of early endosomes and to disrupt retrograde axonal trafficking of nerve growth factor (NGF) signals. The functional impacts of APP and its various products were investigated in PC12 cells, cultured rat basal forebrain cholinergic neurons (BFCNs), and BFCNs from a mouse model of DS. We found that the full-length wild-type APP (APPWT) and β-CTF both induced endosomal enlargement and disrupted NGF signaling and axonal trafficking. β-CTF alone induced atrophy of BFCNs that was rescued by the dominant-negative Rab5 mutant, Rab5S34N. Moreover, expression of a dominant-negative Rab5 construct markedly reduced APP-induced axonal blockage in Drosophila. Therefore, increased APP and/or β-CTF impact the endocytic pathway to disrupt NGF trafficking and signaling, resulting in trophic deficits in BFCNs. Our data strongly support the emerging concept that dysregulation of Rab5 activity contributes importantly to early pathogenesis of AD and DS.
Alzheimer’s disease (AD) is a progressive neurodegenerative disorder causing memory loss and cognitive decline unless disease-modifying treatments are applied (1–6). The classical neuropathological hallmarks, Aβ-amyloid–containing plaques and tau-containing neurofibrillary tangles, have stimulated studies to define mechanisms of neurodegeneration (1–3, 6–12) that have guided clinical trials (13–16).
Dysfunction of the endocytic system, manifested by enlargement of Rab5+ early endosomes, is another important neuropathological marker in AD (17–21). Rab5, a small GTPase, regulates endocytosis and intracellular trafficking (22, 23). By cycling between an active form (GTP-bound) and an inactive state (GDP-bound), Rab5 dictates endocytosis, trafficking, and sorting of surface cargoes (18, 19, 22, 23). In AD, abnormal enlargement of Rab5+ early endosomes is not only characteristic, it occurs early on; it was observed in individuals with sporadic AD (24). Interestingly, endosomal pathology was detected in brain regions free of Aβ or tau pathology (24, 25). In people with Down syndrome (DS), enlarged Rab5+ endosomes were also observed occurring as early as in the fetal period (26–28). Early endosome abnormalities precede not only the onset of dementia but also the emergence of plaques and tangles. Therefore, dysregulation of Rab5 activity and of the endocytic pathway are early features in both AD and DS.
The mechanism(s) leading to endosomal changes in AD and DS remain undefined. Studies have shown that increased gene dose for the amyloid precursor protein (APP), triplicated in DS, is linked to endosomal abnormalities in DS (19, 26, 28, 29). APP is sequentially cleaved by either β- or α-secretase to produce the corresponding C-terminal fragments: β-CTF (or C99) or α-CTF (or C83) (refs. 30, 31, and Supplemental Figure 1A; supplemental material available online with this article; doi:10.1172/JCI82409DS1). Cleavage of the β-CTF by γ-secretase yields the APP intracellular domain (AICD) and Aβ peptides; γ-secretase cleavage of α-CTF yields AICD and P3 (refs. 32–34 and Supplemental Figure 1A). The toxicity of Aβ peptides (Aβ40/42) has been extensively studied in AD (1, 4, 5, 8); the role(s) of full-length APP and/or its CTFs in AD pathogenesis are less well understood (35). Nevertheless, increased APP gene dose in DS, which results in increased levels of the full-length APP and its CTFs, is linked to endosomal pathology (24, 26, 28). Recent findings for β-CTF–mediated changes in endosomes in fibroblasts further support that APP is linked to endosomal dysfunction (19, 26, 28, 29, 36). However, important questions remain: (a) What APP product(s) cause dysregulation of early endosomes; (b) Which physiological events are impacted, and of these, which might contribute to AD pathogenesis in DS? In the Ts65Dn mouse model of DS, increased App gene dose–mediated enlargement of Rab5+ endosomes (26, 28, 37) was correlated with reduced endosomal trafficking and signaling of nerve growth factor (NGF), leading to degeneration of basal forebrain cholinergic neurons (BFCNs) (28, 38). Noteworthy was the inverse correlation between APP CTFs and the degree to which transport was reduced (28). Further, expression of either the wild-type human APP or a mutant APP also caused a reduction in NGF transport in Ts65Dn mice (28). Additionally, the γ-secretase inhibitor (GSI) semagacestat, which eliminates all Aβ species while increasing APP-CTF levels, has shown severe adverse effect in clinical trials, which is likely associated with APP CTFs in AD patients (13, 14, 39, 40). APP CTFs have since been shown to induce neuronal dysfunction and cognitive deficits in animal models (41–44).
We investigated the mechanism and physiological significance of excessive APP and its CTFs on neuronal function by examining endosomal trafficking of NGF (45–47), critical for BFCNs (48–50). Retrograde axonal trafficking of NGF to BFCN soma is mediated by Rab5+ endosomes (48, 49, 51, 52). The selective loss of NGF signals is a prominent feature in both AD and DS. We demonstrated that full-length APPWT, a β-cleavage–resistant mutant (APPM596V), the familial AD (FAD) Swedish mutant (APPSWE), and β-CTF all induced Rab5 activation and enlargement of Rab5+ endosomes. Furthermore, expression of full-length APPWT or β-CTF impaired NGF signaling and retrograde axonal transport, resulting in atrophy of BFCNs. These effects were rescued by expression of a dominant-negative Rab5 mutant both in vitro and in vivo, demonstrating a direct role for increased Rab5 activation in disruption of NGF trafficking and signaling in AD and DS. Thus, activation of Rab5 is an early neuropathology that may contribute to neurodegeneration in these diseases.
Rab5+ endosomes were enlarged in cultured BFCNs from Ts65Dn mice. To study the mechanism(s) by which App gene dose impacts the endosomal pathway, we used primary BFCNs from Ts65Dn mice, harboring three copies of the App gene (28, 38, 53). E18 BFCNs from Ts65Dn mice and 2N controls were dissected and cultured in vitro for 7 days (DIV7). Immunostaining was used to confirm the presence of cholinergic, NGF-responsive neurons in the culture with specific antibodies against choline acetyltransferase (ChAT), a marker for cholinergic neurons, and TrkA, the receptor for NGF. The majority of neurons (>90%) were positive for both markers (Figure 1A). Rab5+ puncta, as stained with a specific antibody, were seen in cell bodies and in processes. In 2N neurons, Rab5+ puncta, of various sizes, showed a uniform, smoothly rounded shape (Figure 1B, arrowheads). In Ts65Dn neurons, puncta were larger and their shapes less uniform, frequently appearing as lobular. The average area of puncta was significantly (P < 0.0001) increased by approximately 60% in Ts65Dn as compared with 2N neurons (Figure 1C). Histogram analysis showed that Ts65Dn neurons had a significant decrease in the number of the smallest Rab5+ puncta (<0.3 μm2), concomitant with a significant increase in the largest puncta (>0.6 μm2). In this largest bin, the increase was approximately 4-fold of that in 2N neurons. Thus, Rab5+ endosomes were markedly altered in Ts65Dn neurons (Figure 1D).
Rab5+ early endosomes were enlarged in primary BFCNs of Ts65Dn mice. (A) Representative images of primary BFCNs (DIV7) were costained for the cholinergic neuronal marker ChAT (red) and the NGF receptor TrkA (green). DIC and merged images are also shown. Scale bars: 10 μm. (B) Representative images are shown for Rab5 staining of BFCNs from Ts65Dn (right) and 2N littermates (left). The sizes of Rab5+ puncta in BFCNs from Ts65Dn and 2N littermates were quantified using ImageJ. Insets: Zoom-in (×2) images of selected areas. Scale bar: 15 μm. (C) Measurement of Rab5+ puncta in B. The average area was 0.468 μm2 (n = 308) for Ts65Dn, 0.295 μm2 (n = 509) for 2N. The measurements were from 3 experiments, with 20–30 cells analyzed each time. (D) The size distribution of Rab5+ puncta in BFCNs from Ts65Dn mice showed a shift from smaller to larger binned areas in comparison to those from 2N littermates. All data represent mean ± SEM (n = 3), and P values were calculated using Student’s t test. n.s., nonsignificant.
The increase in Rab5+ puncta size was likely due to enhanced activation of Rab5, i.e., GTP-Rab5 (22), which induces homotypic fusion of early endosomes, causing their enlargement (19, 22, 23, 26, 54, 55). We assayed the level of GTP-Rab5 in brains of 12-month-old Ts65Dn and 2N mice following a published protocol (56). As previously reported (28), the level of full-length APP in Ts65Dn was approximately 1.5-fold than in 2N samples (Figure 2A). A significant, approximately 60% increase in the level of GTP-Rab5 was seen in Ts65Dn as compared with 2N samples (P = 0.044) (Figure 2, A and B). To test the effect of App gene dose on activated Rab5, we examined 2N mouse lines with 2, 1, or 0 copies of the App gene (App+/+, App+/–, and App–/–). The levels of the full-length APP protein in embryonic brain tissues, as assayed by immunoblotting, mirrored their respective genotypes (Figure 2C). The level of GTP-Rab5 in App–/– mice was approximately 70% (P = 0.002) and in App+/– mice approximately 85% (P = 0.201) relative to that in App+/+ mice (Figure 2, C and D). The level of GTP-Rab5 in mouse brain thus correlates inversely with APP gene dose.
The level of GTP-Rab5 correlated with App gene dose in mouse brain tissues. (A) Protein levels of APP, GAPDH, GTP-Rab5, and total Rab5 in brain homogenates from 12-month-old Ts65Dn and 2N littermates were assayed as described in Methods. (B) The levels of GTP-Rab5 in these samples were quantitated and normalized against internal control, showing a 73% increase in 12-month-old Ts65Dn samples relative to 2N littermates. The level of GTP-Rab5 in 2N littermates was set at 1. (C) The protein level of APP in the brain homogenates from E17 App+/+, App+/–, and App–/– embryos was detected using an antibody against the C-terminus of APP (top lane). The level of GTP-Rab5 in App+/+ mouse brains was set at 1, with the relative levels shown in D. (E) APP levels were detected in BFCNs of Ts65Dn mice that were treated with control or APP siRNA; β-tubulin was used as a loading control. (F) The size of Rab5+ puncta was significantly reduced by APP siRNA, compared with control siRNA (ctr siRNA). (G) Representative images showing Rab5 staining of BFCNs from Ts65Dn mice with APP knockdown (right) and control siRNA (Scramb., scrambled; left). Insets: Zoom-in (×2.5) images of the selected areas. Scale bars: 15 μm. All data represent mean ± SEM of >3 independent experiments, and P values were calculated using Student’s t test.
We next tested whether the increase in App gene dose in Ts65Dn BFCNs was responsible for enlargement of Rab5+ endosomes (Figure 1). By immunoblotting, the APP siRNA caused an approximately 30% reduction in the level of full-length APP, as compared with control siRNA (Figure 2E). Rab5+ puncta in BFCNs treated with either the APP siRNA or control siRNA were analyzed (Figure 2, F and G) as in Figure 1. Large, sometimes lobulated Rab5+ puncta were seen in cultures treated with the control siRNA, whereas these structures were typically smaller and rounded in cultures treated with the APP siRNA (Figure 2G). Treatment with the APP siRNA significantly reduced the size of Rab5+ puncta in Ts65Dn neurons to a value equivalent to that in 2N neurons (Figure 2F). Thus, increased App gene dose is necessary for increased Rab5 activation and for early endosome enlargement in Ts65Dn neurons.
Full-length APP and β-CTF caused enlargement of early endosomes in PC12 cells. To determine how increased APP expression caused an increase in Rab5 activation, we asked which APP product(s) were responsible (Supplemental Figure 1A). We transfected PC12M cells with full-length APP-GFP, C99-GFP (β-CTF), C83-GFP (α-CTF), or AICD-GFP and examined endosomes by live cell imaging (Supplemental Figure 1B). Bright foci of GFP+ intracellular structures were present in PC12M cells that overexpressed APP-GFP or C99-GFP. In contrast, cells expressing C83-GFP or AICD-GFP showed diffuse, hazy signals for GFP, with occasional foci in C83-GFP cells. In APP-GFP and C99-GFP cells, the GFP+ intracellular structures were, on average, approximately 2 μm2 (Supplemental Figure 1E). GFP signals in C83-GFP or AICD-GFP cells contained speckled small puncta within the haze, as well as a small number of larger bright puncta, as seen in cells expressing C99-GFP and APP-GFP (Supplemental Figure 1B). However, the average puncta size in C83-GFP and AICD-GFP cells was approximately 1.2 and 1.3 μm2, respectively. Thus, overexpressing APP and β-CTF, but not α-CTF or AICD, routinely induced formation of enlarged, bright intracellular structures. We also tested two APP mutants: APPM596V and APPSWE. APPM596V, which abolishes β-secretase cleavage, prevents production of β-CTF (57); APPSWE enhances β-secretase cleavage to increase the level of β-CTF (57). Both induced the formation of enlarged intracellular structures (Supplemental Figure 1C).
We examined colocalization of APP or C99 with Rab5 in cotransfection experiments; APP-mCherry with GFP-Rab5WT (Figure 3B); C99-GFP with mCherry-Rab5WT (Figure 3C); and C83-GFP with mCherry-Rab5WT (Figure 3D). As a control, EGFP was also cotransfected with mCherry-Rab5WT (Figure 3A). Cotransfection of mCherry-Rab5WT with EGFP yielded small cytoplasmic Rab5+ puncta, with an increase in the number located in the perinuclear region (Figure 3A). APP+ puncta were typically circular and quite large, with a bright rim and a dark center (Figure 3B); these structures colocalized with mCherry-Rab5WT (Figure 3B). C99 expression induced large puncta that also colocalized with mCherry-Rab5WT (Figure 3C). Though APP and C99 induced very similar changes, the overall extent of colocalization with Rab5 appeared to be greater for C99 (Figure 3, B and C). C83 expression (Figure 3D) did not induce these changes; the size and distribution of early endosomes were similar to the EGFP-expressing control (Figure 3A), except that in these small vesicles, C83 colocalized with mCherry-Rab5WT (Figure 3D). Thus, overexpression of APP and C99, but not C83, resulted in enlargement of early endosomes.
Full-length APP and C99, but not C83, induced the enlargement of Rab5+ endosomes in PC12M cells. PC12M cells were cultured on glass coverslips and cotransfected with the indicated plasmids. Live cell imaging was performed as described in Methods. Images of DIC, FITC, and Texas Red channels were collected, and representative images are shown. Images for cotransfection of mCherry-Rab5WT with EGFP served as the control (A). (B) Cotransfection of EGFP-Rab5WT with APP-mCherry. Cotransfection of mCherry-Rab5WT with (C) C99-GFP or (D) C83-GFP. Insets: Zoom-in (×2.5) images of the selected areas. Scale bars: 10 μm.
Accumulation of β-CTF (C99) induces synaptic toxicity with a detrimental effect on neuronal function (41–43, 58–60). To explore whether C99-induced changes might be reflected in endosome structure and function, we tested APPSWE-YFP and APPM596V-YFP; expression of APPSWE provided a means to markedly increase C99 (57), while APPM596V enabled us examine the effect of full-length APP in the absence of C99 (57). These constructs were coexpressed in PC12 cells with mCherry-Rab5WT. Cells expressing either APPSWE (Figure 4A) or APPM596V (Figure 4B) exhibited enlarged intracellular structures similar to those seen with full-length APP and C99 (Figure 3, B and C). These large circular structures, albeit to a more dramatic extent in cells expressing APPM596V (Figure 4B), had a bright rim and a dark center, and colocalized extensively with mCherry-Rab5WT, indicating that full-length APP and C99 act to increase the size of early endosomes.
APPSWE and APPM596V induced the enlargement of Rab5+ endosomes in PC12M cells. As in Figure 3, mCherry-Rab5WT was cotransfected into PC12M cells with APPSWE-YFP (A), APPM596V-YFP (B), Rabex-5–GFP (C), or GFP-Rab5Q79L (D). Scale bars: 10 μm. Rab5+ endosomes are indicated by arrowheads. Insets: Zoom-in (×2.5) images of the selected areas. The size of Rab5+ endosomes for each APP constructs was quantified using ImageJ, and the results are shown in E (***P < 0.001), with the size distribution of Rab5+ endosomes shown in F. All P values were calculated using Student’s t test.
We predicted that increased Rab5 activation would produce similar effects. Indeed, extremely large vesicular structures were seen within the cytoplasm of the cell expressing either Rabex-5–GFP (RAB guanine nucleotide exchange factor 1 for Rab5) (ref. 61 and Figure 4C) or GFP-Rab5Q79L, a constitutively active mutant of Rab5 (ref. 62 and Figure 4D). Colocalization with mCherry-Rab5WT was readily appreciated in these cells (Figure 4, C and D).
Quantitative analysis confirmed that overexpression of the full-length APP, or two APP mutants (APPM596V, APPSWE), or C99 significantly increased the size of Rab5+ puncta (Figure 4, E and F). C83 had no significant impact in these measures (Figure 4, E and F), providing further evidence that β-CTF and α-CTF have very different effects on Rab5+ endosomes. Consistent with reports that altered processing or increased gene dose of APP contributed to enlargement of Rab5+ endosomes in AD and DS (18, 26, 36), these results have shown that both full-length APP and β-CTF induce enlargement of Rab5+ early endosomes, likely through upregulating Rab5 activation.
Full-length APP and C99 induced endosomal enlargement by enhancing activation of Rab5. To determine whether increased expression of full-length APP and C99 enhanced activation of Rab5, the full-length APP-GFP, APPSWE-YFP, APPM596V-YFP, or C99-GFP each was expressed in PC12M cells. EGFP was used as a negative control and Rabex-5 as a positive control. Twenty-four hours after transfection, GTP pull-down assays were used to measure the level of activated Rab5 (56). Each of the APP constructs and C99 induced a large increase in activated Rab5, as did Rabex-5 (Figure 5, A and B). In contrast, neither C83-GFP nor AICD-GFP induced increased Rab5 activation (Figure 5, A and B; see also Supplemental Figure 2A). The data thus demonstrate that full-length APP, APPSWE, APPM596V, and C99 all induced activation of Rab5 and enlargement of early endosomes.
APP, APP mutants, or C99 induced hyperactivation of Rab5 in PC12M cells. PC12M cells were cultured and transfected with the indicated constructs. The levels of GTP-Rab5 were assayed as in Figure 2. The levels of total Rab5 were blotted as loading controls (A). The results were quantitated and are presented in B. The level of GTP-Rab5 in untransfected cells was set at 100%. (C) PC12M cells were treated with either vehicle or 1 μM GSI for 24 hours, and cell lysates were analyzed by SDS-PAGE/immunoblotting with the indicated antibodies. Both full-length APP (fl APP) and APP CTFs are shown. The levels of activated Rab5 and total Rab5 are also shown. (D) PC12M cells were transfected with mCherry-Rab5WT for 24 hours and were treated with either 1 μM GSI or vehicle for another 48 hours. Cells were fixed and analyzed by use of a Leica TCS SPE confocal microscope with a ×63 oil objective lens. Representative images of mCherry-Rab5WT puncta are shown. Enlarged mCherry-Rab5WT puncta by GSI treatment are highlighted in the inset (×1.6; arrowheads). Scale bars: 10 μm. The sizes of mCherry-Rab5WT puncta from 25–30 transfected cells were quantitated, and the size distribution pattern is shown in E. Data represent mean ± SEM of at least 3 independent experiments. All corresponding P values were calculated using Student’s t test.
To ask whether increased levels of C99, not Aβ peptides, were responsible for the increase in Rab5 endosomal size, we tested a GSI (BMS-299897) that blocks production of all Aβ species while increasing the level of C99 (40, 63–70). Treatment of PC12 cells with 1 μM GSI for 48 hours caused a marked increase in the level of CTFs, as detected by immunoblotting with an antibody specific to the C-terminus of APP, with little effect on the level of full-length APP (Figure 5C). In comparison with vehicle treatment, GSI treatment of cells expressing mCherry-Rab5WT for 48 hours induced apparent enlargement of mCherry-Rab5WT endosomes (Figure 5D). Quantitative analysis showed that GSI treatment induced a significant decrease in the size of smaller mCherry-Rab5WT puncta (0.2–0.4 μm2), with a concomitant increase in larger puncta (0.6 to ≥1.0 μm2) (Figure 5E).
To test whether increased Rab5 activation was necessary for the effect of APP-GFP or C99-GFP on endosomal size, we coexpressed these constructs with a dominant-negative mutant, mCherry-Rab5S34N (22, 55), which resulted in the disappearance of bright intracellular GFP foci (Supplemental Figure 1, D versus B). Quantitative analyses revealed a reduction in both the size (Supplemental Figure 1E) and number (Supplemental Figure 1F) of GFP puncta, as was evident in the frequency distribution of GFP+ vesicles (Supplemental Figure 1G). We thus conclude that overexpression of APP or C99 acted through Rab5 activation to increase size across the entire population of early endosomes.
Full-length APP or C99 inhibited NGF-mediated neurite outgrowth in PC12M cells. Endocytosis is essential for NGF-mediated neurite outgrowth in PC12 cells (71, 72). Increased Rab5 activation compromised endocytic trafficking of NGF signaling complexes and blocked NGF signaling in PC12 cells (71). PC12M cells were transfected with EGFP, full-length APP-GFP, C99-GFP, C83-GFP, APPM596V–YFP, or Rabex-5–GFP. NGF (50 ng/ml) was added to the culture 24 hours after transfection to induce differentiation for 2 days. The length and number of neurites were quantitated. Representative images are shown in Figure 6A, and the quantitative results in Figure 6, B and C. Cells transfected with EGFP demonstrated numerous long, neuron-like processes, some terminating in growth cone–like structures; on average there were 3.75 ± 0.17 neurites/cell (Figure 6B). The mean length of neurites in EGFP-expressing cells was 91.98 ± 4.08 μm (Figure 6C). PC12M cells transfected with APP-GFP, APPM596V-YFP, or C99-GFP demonstrated a significant reduction in both the number of neurites/cell (2.19 ± 0.11, 2.91 ± 0.18, and 2.81 ± 0.17, respectively) and the mean length of neurites (43.73 ± 3.23 μm, 58.8 ± 4.62 μm, and 55.95 ± 4.45 μm, respectively) (Figure 6, B and C). In contrast, expression of C83-GFP resulted in no significant differences relative to the EGFP control in these measures (neurite number/cell: 3.60 ± 0.26; mean neurite length: 93.28 ± 6.09 μm) (Figure 6, A–C). To test whether increased Rab5 activation would result in reduction in neurite outgrowth and number, we tested Rabex-5–GFP, which induced hyperactivation of Rab5 (Figure 4C and Supplemental Figure 3). Neurites were significantly fewer in number (2.35 ± 0.20 neurites/cell) and shorter (39.33 ± 3.66 μm) with expression of Rab5ex-5–GFP (Figure 6, A–C).
APP, APP mutants, or C99 inhibited NGF-induced neurite outgrowth that was rescued by Rab5S34N. PC12M cells were transfected with the indicated plasmids and treated with 50 ng/ml NGF for 48 hours. The length and the number of neurites of each cell were measured and quantitated using ImageJ. Representative images are shown in A. The number of the neurites/cell (B) and the average length (C) in each condition are measured, and the results are shown. (D–F) Rab5S34N-GFP or Rab5S34N-mCherry was cotransfected with APP-mCherry or Rabex-5–GFP into PC12M cells (D). Cells were then induced for differentiation. The number of the neurites/cell (E) and the average length (F) of each condition were measured, and the results are shown. All P values were calculated using Student’s t test; ***P < 0.001. Scale bars: 20 μm.
To determine whether the decrease in neurite elaboration and growth detected in studies involving overexpression of APP constructs were due to increased Rab5 activation, we cotransfected GFP-Rab5S34N/APP-mCherry or mCherry-Rab5S34N/Rabex-5–GFP into PC12M cells. Cells were then treated with NGF (50 ng/ml) to induce neurite outgrowth. Cells coexpressing Rab5S34N/APP or Rab5S34N/Rabex-5 showed a statistically significant increase in neurite length (63.21 ± 4.88 μm and 74.14 ± 3.84 μm, respectively) compared with cells expressing APP or Rabex-5 alone (Figure 6, D and E). Expression of Rab5S34N also increased the number of neurites per cell; for those also expressing Rabex-5, the increase was statistically significant (Figure 6F). We thus conclude that the disruption of the effects of NGF signaling on neuronal differentiation mediated by increased expression of APP and C99 was due, at least in part, to increased activation of Rab5.
Because sustained activation of the MAPK pathway contributes significantly to neuronal differentiation of PC12 cells in response to NGF, we assessed activation of Erk1/2 in cells that expressed C99 and C83 following NGF treatment. Consistent with earlier studies (73–75), expression of C99 markedly suppressed NGF-induced activation of Erk1/2 at both 5 and 30 minutes (Supplemental Figure 2, B and C). While having no effect at 5 minutes, C83 induced a small decrease in pErk1/2 at 30 minutes. Therefore, APP and C99, and to lesser extent C83, impacted NGF signaling through the MAPK pathway.
Full-length APP or C99 induced enlargement of early endosomes and atrophy of BFCNs. BFCNs are selectively impacted in AD and DS (50, 51, 76–82). NGF plays a critical role in supporting the differentiation and maintenance of these neurons (27, 48, 79, 83–87). The Ts65Dn mouse model recapitulates age-related atrophy of BFCNs, to which APP gene dose contributes prominently (28, 38). Importantly, neuronal atrophy is correlated with APP gene dose–mediated disruption of retrograde NGF transport to BFCNs from the hippocampus (28). We asked whether APP or C99 compromised NGF signaling and trafficking in BFCNs in vitro. Following cotransfection of primary rat E18 BFCNs with mCherry-Rab5WT and APP-GFP or various CTF-GFP constructs at 6 days in vitro (DIV6), we used live cell imaging to examine endosomes. Representative images are shown in Figure 7, A–E. As in PC12M cells, BFCNs overexpressing APP-GFP (Figure 7B, inset), C99-GFP (Figure 7C, inset), or APPM596V-YFP (Figure 7E, inset) exhibited enlarged Rab5+ endosomes, all showing extensive colocalization with Rab5. EGFP or C83-GFP did not cause these changes (Figure 7, A and D).
APP, APPM596V, or C99 induced the enlargement of Rab5+ endosomes in BFCNs. Primary rat E18 BFCNs were cultured on poly-l-lysine–coated glass coverslips. Neurons (DIV6) were transfected with the indicated plasmids for 24–48 hours. Live imaging was performed as described in Methods. Images of DIC, red, and green channels were captured. Representative images of BFCNs are shown for cotransfection: mCherry-Rab5WT/EGFP (A), mCherry-Rab5WT/APP-GFP (B), mCherry-Rab5WT/C99-GFP (C), mCherry-Rab5WT/C83-GFP (D), mCherry-Rab5WT/APPM596V-YFP (E). Arrowheads indicate Rab5+ endosomes. Overexpression of APP-GFP, APPM596V-YFP, and C99-GFP induced enlarged Rab5+ endosomes. Scale bars: 10 μm; magnification (insets), ×3.5.
We quantitated the size of Rab5+ puncta in BFCNs that overexpressed EGFP, APP-GFP, C99-GFP, C83-GFP, or APPM596V-YFP (Figure 8A). The results showed an increase in size of 18% for APP-GFP, 27% for C99-GFP, and 29% for APPM596V-YFP in comparison to BFCNs expressing EGFP (Figure 8A). The distribution of Rab5+ puncta in BFCNs expressing these constructs also showed a shift in sizes from smaller to larger binned areas (Figure 8B), reflecting an apparent effect on the entire population of Rab5+ endosomes. We measured the level of GTP-bound Rab5. The results showed increases in activated Rab5, in comparison to the control, of 45.7% and 52.2% in BFCNs transfected with APP-GFP and C99-GFP, respectively (P < 0.05) (Figure 8, C and D). In contrast, overexpression of C83-GFP did not increase the level of GTP-Rab5 (Figure 8, C and D); nor did C83 expression induce an increase in the size of Rab5+ endosomes. Therefore, increased expression of APP or C99, but not C83, induced activation of Rab5 and enlargement of Rab5+ early endosomes in BFCNs.
APP and C99 increased the level of GTP-Rab5 in BFCNs. (A) The size of Rab5+ endosomes in primary BFCNs from experiments in Figure 7 was quantified using ImageJ. The endosomal size distribution for APP-GFP, APPM596V-YFP, and C99-GFP showed a shift in sizes from smaller to larger binned areas as compared with that for EGFP and C83-GFP (B). Data represent the mean value of three independent experiments. (C and D) The levels of GTP-Rab5 and total Rab5 were also measured in BFCNs that expressed these various constructs. The level of GTP-Rab5 in untransfected cells was set at 100% (D). Data represent mean ± SEM of at least 3 independent experiments. All P values were calculated using Student’s t test.
C99, not C83, disrupted retrograde transport of NGF and inhibited NGF signaling in BFCNs. Retrograde axonal transport and signaling of NGF support the maintenance and function of BFCNs (46, 47, 51, 88). Because increased App gene dose reduced retrograde axonal transport of NGF from hippocampus to the basal forebrain in Ts65Dn mice (28), we asked whether APP and C99 overexpression impacted retrograde transport of NGF in BFCNs. Quantum dot–labeled NGF (QD-NGF) was used to track the axonal transport of NGF by live cell imaging (89, 90). Primary cultures of rat E18 BFCNs were maintained in microfluidic culture chambers, in which axons are separated from the corresponding cell bodies (91). To examine the Rab5+ endosomes in axons, we transfected BFCNs at DIV7 with mCherry-Rab5WT together with EGFP, C99-GFP, or C83-GFP (Figure 9, A–C). The axons of neurons cotransfected with EGFP showed diffuse mCherry-Rab5WT signals with occasional distinct rounded puncta (Figure 9A, arrowheads). A similar appearance was found in axons of neurons cotransfected with C83-GFP and mCherry-Rab5WT, with colocalization of the latter in small puncta (Figure 9C). In contrast, the axons of C99-GFP–transfected neurons showed distinct differences. The signals for mCherry-Rab5WT were concentrated within varicosities containing enlarged Rab5+ structures; puncta were also seen between varicosities, with most puncta showing colocalization of Rab5 and C99-GFP (Figure 9B, arrowheads).
C99 inhibited retrograde axonal transport of NGF in BFCNs. (A) Rat E18 BFCNs were cultured in microfluidic chambers and were cotransfected with the indicated expression vectors. Live imaging was performed as described in Methods. Representative images of axons of BFCNs are shown for mCherry-Rab5WT/EGFP (A), mCherry-Rab5/C99-GFP (B), and mCherry-Rab5/C83-GFP (C) Arrowheads indicate the enlarged Rab5+ structures that colocalized with C99-GFP. Scale bars: 5 μm. (D–G) Representative images and kymographs of axonal transport of QD-NGF signals. Scale bars: 10 μm. Retrograde movement (H), average velocities (I), and pause time (J) of the QD-NGF signals in axons were quantitated. Significantly slowed retrograde transport and longer pause time are seen for C99-GFP–transfected axons as compared with untransfected control or with C83-GFP–transfected axons (C–E). Data represent mean ± SEM of at least 3 independent experiments. All P values were calculated using 1-way ANOVA.
To ask whether overexpression of C99 impacted axonal transport, we examined live imaging of axonal transport of QD-NGF 24 hours after transfection. Time-lapse image series were captured, and kymographs were generated; representative images with corresponding kymographs for each condition are shown (Figure 9, D–G, and Supplemental Videos 1–4). When compared with either EGFP- or C83-GFP–transfected neurons, there was a significant reduction in both the moving (i.e., instantaneous) (Figure 9H) and average (Figure 9I) velocities of QD-NGF in axons of BFCNs expressing C99-GFP. The moving velocity of QD-NGF in C99-GFP–transfected neurons was significantly reduced with respect to both EGFP-expressing neurons (by approximately 16.5%; P = 0.002) and C83-GFP–expressing neurons (by 13.5%; P = 0.001) (Figure 9H). The moving velocities for QD-NGF did not differ among control, EGFP-expresssing, and C83-GFP–expressing neurons (P = 0.644) (Figure 9H). The average velocities of QD-NGF in C99-GFP–transfected neurons were also reduced, to 62.9% (P = 0.024) of those in EGFP neurons and to 62.6% (P = 0.015) of those in C83-GFP neurons (Figure 9I). Again, the average velocities of QD-NGF did not differ among control, EGFP-expressing, and C83-GFP–expressing neurons (P = 0.979) (Figure 9I). In addition, we examined the number of stationary (pause) periods between moving segments. Such periods were significantly increased for QD-NGF signals within axons of C99-GFP neurons. The increase amounted to 36.4% (P = 0.021) as compared with EGFP- and 41.7% (P = 0.003) as compared with C83-GFP–transfected neurons, respectively (Figure 9J). C99-GFP thus induced significant changes in retrograde axonal transport of NGF in BFCNs.
GSIs that block production of all Aβ species while increasing the level of CTFs, including C99 (63–70), caused a marked increase in Rab5 activation and enlargement of Rab5+ endosomes (Figure 5, C–E). We reasoned that GSI would disrupt retrograde axonal transport of NGF. Using the same culture system as for BFCNs overexpressing APP and its products, we found that a 24-hour pretreatment with 1 μM GSI resulted in significant impairment of retrograde axonal transport of NGF. Representative kymographs (vehicle versus GSI) showed significant differences from control cultures (Figure 10A and Supplemental Videos 5 and 6). GSI treatment caused a marked decrease in moving velocity (Figure 10B); moreover, it reduced the percentage of NGF moving retrogradely (Figure 10C) while increasing the percentage that moved anterogradely or paused (Figure 10C). We conclude that C99 disrupts retrograde axonal transport of NGF in BFCNs.
GSI induced hyperactivation of Rab5 and inhibited retrograde axonal transport of NGF in BFCNs. Rat E18 BFCNs (DIV6) were cultured in microfluidic chambers, and both the cell body and the distal axonal chamber were treated with either vehicle or 1 μM GSI for 2 hours. Live imaging of QD-NGF was performed as described in Methods. (A) Representative kymographs derived from time-lapse image series of axonal transport of QD-NGF from vehicle- and GSI-treated samples. (B) Retrograde moving speed and (C) breakdowns of transport directionalities (retrograde, stationary, and anterograde) for vehicle- and GSI-treated samples. Data represent mean ± SEM of at least 3 independent experiments. The P value was calculated using Student’s t test.
Atrophy of BFCNs induced by C99 was prevented by dominant-negative Rab5. Reduced axonal transport of NGF would result in decreased transport of trophic signals from axons to cell bodies. To measure NGF signaling in BFCNs, we examined immunostaining for the phosphorylated form of cAMP response element–binding protein (CREB), an important element downstream of axonally transported NGF-TrkA signals (46, 47, 92). E18 BFCN neurons that were cultured in microfluidic chambers were transfected with EGFP (Supplemental Figure 4), C99-GFP (Supplemental Figure 3), or C83-GFP (Supplemental Figure 4), followed by immunostaining of cell bodies with a specific antibody to pCREB. NGF (50 ng/ml) was supplied to only the axonal chambers for 72 hours before examination of pCREB. In comparison to EGFP- or C83-GFP–expressing neurons, there was a marked reduction in pCREB signals in C99-GFP–expressing neurons (Supplemental Figure 4).
Since the size of BFCN soma is regulated by NGF (93), we examined the effect APP overexpression on NGF signaling by measuring the soma size of BFCNs 48 hours after transfection with EGFP, APP, C99, or C83; in each case, the media bathing cells contained 50 ng/ml NGF. As shown in Figure 11A, the area of BFCN cell bodies that overexpressed APP-GFP (P = 0.0075) and C99-GFP (P = 0.0488) was markedly decreased. The sizes of BFCNs that overexpressed C83-GFP tended to be smaller than those transfected with EGFP, but the effect failed to reach significance (P = 0.3144) (Figure 11A). To ask whether C99-induced atrophy could be overcome by increasing the concentration of NGF, we set up microfluidic chamber cultures and transfected cells with either EGFP or C99-GFP. The cultures were maintained in 10, 50, and 100 ng/ml NGF provided only in the axonal chamber for 72 hours before measurement of the size of neuronal somata. For EGFP-expressing neurons, increasing NGF concentration from 10 to 50 ng/ml resulted in a marked increase in size of approximately 150 to 190 μm2 (Figure 11B). In contrast, increasing NGF from 10 to 50 ng/ml had no appreciable effect on soma size in C99-GFP–expressing neurons (Figure 11B). At 100 ng/ml NGF, C99-GFP–expressing neurons showed a small increase in soma size, but the increase was not significant, and cell body size was still smaller than that of EGFP-expressing neurons (Figure 11B). Therefore, C99 overexpression markedly impacts retrograde axonal trafficking of NGF signaling as well as the soma size of BFCNs.
C99 induced-atrophy of BFCNs was rescued by Rab5S34N. Rat E18 BFCNs were cultured in microfluidic chambers as described in Methods. (A) Neurons were transfected with the indicated plasmids for 48 hours, and the soma profiles of BFCNs were measured and quantified using ImageJ. (B) BFCNs were transfected with EGFP or C99 and were maintained in medium containing 10, 50, or 100 ng/ml NGF for 48 hours; soma sizes of BFCNs were measured as in A. (C) BFCNs were transfected with the indicated plasmids for 48 hours; the soma profiles of BFCNs were measured as in A and B. All P values were calculated using Student’s t test.
To determine whether activated Rab5 contributed to reduced NGF retrograde transport and signaling in BFCNs, we cotransfected C99-GFP with the dominant-negative Rab5 mutant (mCherry-Rab5S34N) at DIV7 into rat BFCNs cultured in microfluidic chambers. The cultures were maintained for another 72 hours with only axonally added 50 ng/ml NGF. The mean soma size of these neurons was markedly increased as compared with control neurons expressing C99-GFP and mCherry (P = 0.007) (Figure 11C). The size of BFCNs that coexpressed mCherry-Rab5S34N was equivalent to that of BFCNs expressing EGFP and mCherry (P = 0.365) (Figure 11C). Therefore, C99 acts to induce Rab5 activation to disrupt retrograde NGF signaling, resulting in atrophy of BFCNs. Taken together, the results indicate that APP and C99 both act through Rab5 activation to impact the structure and function of early endosomes, causing deleterious effects on the trophic status of BFCNs.
To validate in vivo that APP-induced disruption of axonal transport can be rescued by dominant-negative Rab5, we turned to a transgenic Drosophila model that expresses human APP695 (94). Previous studies have demonstrated that these flies have significant deficits in axonal transport due to APP-induced axonal blockages consisting of synaptic vesicles among other organelles (95) (see Supplmental Figure 4, A and B). Segmental immunostaining of nerve axons in third instar larvae with an antibody against cysteine string protein (CSP), a synaptic vesicle marker, was used to assess axonal blockages (96). The APP695 line had an average of 107 ± 11.44 blockades per larva as compared with 2 ± 0.447 blocks per larva in the ApplGAL4 line (Figure 12B, top row, and Figure 12C). We then performed crosses between the APP695 line and a strain expressing YFP-Rab5WT, YFP-Rab5CA, YFP-Rab5DN, or mCD8-GFP (Figure 12A). The pan-neuronal driver UAS was used to drive the expression of all the transgenes used in the study. We chose mCD8-GFP as a control for the effect of protein overexpression because it is similar in size to YFP-Rab5. The average number of axonal blocks per larva was 18.40 ± 2.11 for mCD8-GFP, 16.80 ± 5.142 for YFP-Rab5WT (P = 0.781), 34.60 ± 11.49 for YFP-Rab5CA (P = 0.203), and 1.0 ± 0.548 for YFP-Rab5DN (P < 0.001) (Figure 12B, bottom two rows, and Figure 12D). Expression of mCD8-GFP or each of the Rab5 constructs alone did not induce axonal blockage (Supplemental Figure 4). However, when coexpressed with APP695, the dominant-negative form Rab5DN, but not Rab5WT or Rab5CA, significantly reduced the presence of axonal blocks. Therefore, consistent with in vitro studies, these results support that APP acts, at least in part, through enhancing activation of Rab5 to induce deficits in axonal transport in vivo.
Expression of dominant-negative Rab5 suppressed APP-mediated axonal blockages in Drosophila larval segmental nerves. (A) Schematic of APP strain with stains that express different Rab5 constructs as well as mCD8 as the control. (B) Axonal blocks (arrowheads) in representative images of Drosophila third instar larval segmental nerves, immunostained with the synaptic vesicle marker cysteine string protein (CSP). Control (ApplGAL4) larvae show smooth CSP staining in larval segmental nerves, indicating no axonal transport defects (top left). Expression of human APP695 causes a severe axonal blockage phenotype (top right). The average number of axonal blocks/larva is shown in C. Coexpression of human APP695 with membrane-bound mCD8-GFP also shows axonal blockages in larval segmental nerves (B, middle left, arrowheads), which was used as a control for the effect of protein overexpression on axonal blockages. Representative images for larval segmental nerves resulted from the cross between human APP695 with wild-type YFP-Rab5WT (middle right), constitutively active YFP-Rab5CA (bottom left), or dominant-negative YFP-Rab5DN (bottom right). Axonal blockages (arrowheads) were quantitated within the entire larvae for each genotype, and the average number of axonal blocks for each genotype is shown in D. Expression of YFP-Rab5DN with APP695 significantly reduced the amount of axonal blocks as compared with larvae expressing human APP695 with mCD8-GFP (P < 0.0001, Student’s t test). Data represent mean ± SEM. Scale bars: 10 μm.
Endolysosomal dysfunction is a characteristic of early neuropathological signature of AD and DS (24, 26, 34, 36, 37, 97). However, it is unclear whether and how such change contributes to neurodegeneration (19, 26, 28, 29). Here, we show that full-length APP and its β-CTF, acting through increased activation of Rab5, induce endosomal pathology with marked deficits in trafficking and signaling of NGF in BFCNs. Our study has revealed a mechanism by which APP and its products contribute to neurodegeneration, raising the possibility that endosomal dysfunction is an early event in neurodegeneration in AD and DS.
At the cellular level, endosomal dysfunction, i.e., the abnormal enlargement of Rab5+ endosome, is present prior to the appearance of plaques and tangles in AD or DS (26, 29, 97). We speculated that endosomal dysfunction might impact the trophic status of BFCNs. NGF is a target-derived neurotrophic factor that supports the survival, differentiation, and maintenance of BFCNs (50, 98). NGF signaling regulates expression of genes and cellular programs important for the BFCN phenotype, including cell size. Following endocytosis, the NGF/TrkA signaling complexes are trafficked to Rab5+ early endosomes. These “signaling endosomes” are then retrogradely transported to the corresponding cell bodies to transmit NGF trophic signals (50, 98). Thus, axonal trafficking mediated by Rab5+ endosomes plays a critical role in maintaining the trophic status of BFCNs, and alteration in these aspects could potentially disrupt axonal transport, resulting in neurodegenerative disorders (88, 99–107).
Rab5-GTP, in concert with tethering proteins and effectors, promotes homotypic fusion of endocytic vesicles and heterotypic fusion of endocytic and trans-Golgi network–derived vesicles with the early endosome, resulting in the enlargement and maturation of early endosomes (22, 23, 38). Accordingly, one measure of the status of Rab5 activity is the size of early endosomes. Since enlargement of Rab5+ endosomes has been well established in DS, we asked might be the impact of increased levels of APP and its products. We found that increased expression of APP or its β-CTF led to hyperactivation of Rab5 and induced abnormal enlargement of the Rab5+ NGF signaling endosomes, likely impairing trophic delivery via axonal transport.
Although the mechanism(s) by which increased levels of full-length APP and its β-CTF result in increased Rab5 activity are unknown, a Rab5 guanidine nucleotide exchange factor (GEF) such as Rabex-5 — shown herein to produce the same effects as APP overexpression — could play a role. Interestingly, RIN3, another Rab5 GEF (108, 109), has been identified in a large-scale genome-wide association study of AD (110). Recruitment of such effectors (19, 111, 112) to endosomes would increase the level of Rab5 on these organelles.
There are at least two scenarios for explaining how increased activation of Rab5 impairs neuronal trophic signaling. The abnormally enlarged Rab5+ endosomes that carry NGF signals may experience greater difficulty in moving retrogradely within the axon, resulting in a net decrease in the signals delivered to the soma, eventually leading to a deficiency in trophic support for BFCNs. Increased Rab5 activation would also promote premature delivery of NGF signals to late endosomes/lysosomes, causing premature degradation of the NGF/TrkA signals (56), which would also decrease trophic support for BFCNs. There may be other mechanisms by which transport kinetics or the stoichiometry of motor proteins (including kinesins) are altered on NGF signaling endosomes. For instance, the C-terminal domain of APP directly (113) or indirectly (114) binds to kinesins that may impact trafficking of NGF signals. APP can also potentially interact with TrkA to influence their trafficking and signaling, as demonstrated recently (75), for the Y682 residue of APP is apparently a target for TrkA (115). Yet it is unclear how the interaction between APP and TrkA or phosphorylation of APP by TrkA is impacted in neurons under conditions where full-length APP and/or β-CTF is accumulated.
The adverse impact of β-CTF on synaptic plasticity and neuronal function has attracted increasing interest (35, 41–44, 58). In our present studies, β-CTF, but not α-CTF, had detrimental effects on neuronal function, although they only differ in the first 16 N-terminal residues (see Methods). We speculate these 16 residues may play a role in mediating the adverse effect of β-CTF. Future studies will be needed to decipher the underlying molecular mechanisms. Furthermore, we demonstrated that a GSI, while inhibiting production of Aβ species (13–15), induced marked accumulation of β-CTFs and increased the level of activated Rab5 (Figure 4C), raising the possibility that excessive β-CTFs contributed to worsening cognitive function in AD patients (13–15, 40).
Endolyosomal changes predispose to other AD markers and pathogenetic events. The link with APP is obvious, especially in view of the trafficking of APP to the endosome and its processing therein, including the production of CTFs and the Aβ peptide. The impact of mutations in APP and presenilin on APP processing and the early endosome are relevant to understanding how FAD creates endosomal pathology. The question of what links may exist between the endosome and plaque formation also deserves attention. Our study highlights the importance of endosomal function in regulating retrograde axonal trafficking and signaling of NGF and provides a mechanistic explanation whereby increased APP expression, via Rab5 activation, compromises retrograde transport of NGF in BFCNs. Future studies will be needed to determine whether reducing Rab5 activation will prevent or reverse neurodegeneration in AD and DS.
Chemicals, reagents, and antibodies. HBSS, Neurobasal, B27, GlutaMAX, Lipofectamine 2000, donkey anti-goat IgG–Alexa 568 conjugates, donkey anti-rabbit IgG–Alexa 488, and streptavidin-QD655 conjugates were from Invitrogen. DMEM high glucose was from Mediatech. FBS was from Phoenix Research Products. HEPES, poly-l-lysine, cytosine-β-d-arabinofuranoside (AraC), and bisbenzimide H (Hoechst 33258) were from Sigma-Aldrich. BMS-299897 (GSI) was from by Steven L. Wagner (UCSD). Mouse purified NGF was as previously published (116). GTP agarose beads were from Innova Biosciences or Sigma-Aldrich.
Mouse anti-GFP IgGs (sc-9996), mouse anti-pErk1/2 (E6) IgGs (sc-271270), and rabbit anti-Rab5B IgGs (sc-598) were from Santa Cruz Biotechnology Inc.; rabbit anti-TrkA was from EMD Millipore (catalog 06-574). Mouse anti-GAPDH IgGs (GT239) were from GeneTex. Rabbit antibodies against pCREB(pSer133) (no. 9191), pErk1/2 (no. 9101), and total Erk1/2 (no. 9102) were from Cell Signaling Technology. Goat anti-ChAT IgGs were from Millipore. Rabbit IgGs against the C-terminus of APP were from Steven L. Wagner. Goat anti-rabbit or anti-mouse IgG–HRP, biotin-SP–conjugated donkey anti-rabbit IgG, and fluorescein-conjugated streptavidin were from Jackson ImmunoResearch Laboratories Inc.
Plasmids and siRNAs. The C99-GFP construct (117) was used to create the C83 and AICD-GFP construct (57). The C83 vector was made by deleting from C99 only the codons for the first 16 amino acid residues (bold), but not the 19-residue secretory signal sequence human APP (underlined) (sequence ID: gb|AAC13654.1|): C99-GFP 1, MLPGLALLLLAAWTARALEDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAI . . . C83 lacks only the 16 residues (bold) of the human β-amyloid peptides (sequence ID: gb|AAB28602.1|) from the C99 construct: C83-GFP 1 MLPGLALLLLAAWTARALE----------------------------------LVFFAEDVGSNKGAI . . . The AICD-GFP construct was made by deleting the Aβ42 sequence from C99, resulting in: M(T)VIVITLVMLKKKQYTSIHHG . . . (T was changed to M for the translational start).
The pcDNA3-APP-EGFP was previously described (118), and the APPM596V-YFP and APPSWE constructs were as previously described (57). GFP-Rab5WT, GFP-Rab5Q79L, and GFP-Rab5S34N plasmids were from Marino Zerial (Max Planck Institute of Molecular Cell Biology and Genetics, Dresden, Germany). The mCherry-Rab5S34N, mCherry-Rab5WT, and APP-mCherry expression vectors were generated by subcloning the cDNAs into the pcDNA3-mCherry vector (56). A full-length Rabex-5 cDNA was generated by PCR using a human brain cDNA library and was cloned into the pEGFP-N1 vector between HindIII and SalI. All sequences were verified by sequencing. The N-TER Nanoparticle Transfection System (Sigma-Aldrich) was used for transfection of siRNA against rat APP (Sigma-Aldrich PDSIRNA2D:SASI_Rn01_00086595 starting at 366) or the MISSION siRNA Universal Negative Control #1 (Sigma-Aldrich SIC001).
PC12M cell culture, transfection, and neurite outgrowth. PC12M cells were maintained and cultured (56). The cells were transfected using Lipofectamine 2000 (Invitrogen). For outgrowth assays, the medium was changed to DMEM containing 50 ng/ml NGF for 48 hours following transfection. Neurites were measured and analyzed using ImageJ (http://imagej.nih.gov/ij/).
GTP-agarose pull-down assays and SDS-PAGE/immunoblotting. The amount of Rab5-GTP was assayed following a published protocol (56). Briefly, mouse brain tissues or cultured cells were lysed (50 mM Tris-HCl pH 7.5, 250 mM NaCl, 5 mM Mg acetate, 0.5% Triton X-100, and protease inhibitor), followed by centrifugation to produce supernatants. An aliquot of supernatants (15–20 μl) was saved as the loading control. The supernatants were incubated with GTP-agarose beads overnight at 4°C with rotation. The beads were washed and boiled. The amount of Rab5-GTP was measured by SDS-PAGE and blotted with an anti-Rab5 antibody.
Established protocols were followed for SDS-PAGE/immunoblotting (105, 119). Equal amounts of proteins were separated on 4-12% NuPAGE Bis-Tris precast gels (Invitrogen) and then electrotransferred to PVDF membranes, which were blocked with 5% nonfat milk and probed with specific antibodies. All blots were captured using ChemiDoc XRS+ (Bio-Rad), and only blots within linear ranges were quantitated using ImageLab 3.0.1 software (Bio-Rad). All experiments were repeated >3 times.
Primary BFCNs culture and transfection. BFCNs were cultured from rat E18 embryos or transgenic mouse E17 embryos as described previously (120). Briefly, basal forebrains were dissected, dissociated, and resuspended in Neurobasal with 10% FBS, B27, GlutaMAX, and 50 ng/ml NGF and plated for 4 hours. Maintenance medium (Neurobasal with B27, GlutaMAX, and 50 ng/ml NGF) was added to the cell culture and incubated for 24 hours before being replaced with antimitotic medium (maintenance medium plus 1 μM AraC) for 12 hours, followed by switching to maintenance medium. For transfection, 0.5 μg DNA and Lipofectamine 2000 were used. An approximately 15%–20% transfection efficiency was achieved. Cells were imaged 24–48 hours after transfection.
Immunofluorescence staining of BFCNs. BFCNs, cultured on PLL-coated glass coverslips, were fixed at DIV7 in 4% PFA, 4% glucose for 15 minutes at 37°C and were permeabilized with 0.15% Triton X-100 in PBS for 10 minutes, followed by blocking with 3% donkey serum in PBS for 1 hour. Neurons were incubated with primary antibodies (1:100 for goat anti-ChAT) overnight at 4°C, rinsed, and incubated with donkey anti-goat IgG–Alexa 568 conjugates (1:500) for 1 hour at room temperature. The samples were then incubated with the other diluted primary antibodies (1:100 for rabbit anti-TrkA and 1:100 for rabbit anti-Rab5B) overnight at 4°C. The samples were rinsed and incubated with biotin-SP–conjugated donkey anti-rabbit IgG (1:500) for 1 hour at room temperature. The samples were rinsed and incubated with fluorescein-conjugated streptavidin (1:500) for 1 hour at room temperature. Nuclei were stained with Hoechst 33258 (0.1 μg/ml). All images were collected with a Leica inverted microscope (DMI6000B) with a ×100 oil objective lens.
Live cell imaging, axonal transport of QD-NGF, and confocal microscopy. PC12M cells or BFCNs were observed using the Leica inverted microscope, and images were captured using a Rolera MGi Fast 1397 camera (QImaging) with a ×100 oil immersion objective (HCX PL Fluotar, NA 1.3) (Figure 3, A–D, Figure 4, A–D, Figure 6, A and D, and Figure 7, A–E) (89). The microscope was equipped with an environmental chamber (5% CO2, 37°C). Immediately before imaging, maintenance medium was replaced by CO2-independent medium. ImageJ was used to measure the size of Rab5+ puncta.
For imaging of axonal transport in BFCNs cultured in microfluidic chambers (89, 90), 0.1 nM QD-NGF was added to the axonal compartment and incubated for 4 hours. Time-lapse images were taken at 1 frame/second for a total of 120 seconds. Analysis of transport were performed using ImageJ.
For confocal microscopy, samples were fixed in 4% PFA for 15 minutes at room temperature. Samples were then stained with antibodies following standard protocols (ref. 56; Figure 1, A and B, Figure 2G, Figure 5D, and Supplemental Figure 1, B–D) or were immediately mounted for transfected samples. The samples were examined by confocal microscopy (Leica TCS SPE) with a ×63 oil objective lens. ImageJ was used to measure the size of Rab5+ puncta.
Drosophila genetics. The UAS human APP695 strain was from Renato Paro (ETH Zurich, Zurich, Switzerland) (94), and the UAS-YFP-Rab5.WT, UAS-YFP-Rab5.CA, UAS-YFP-Rab5.DN, and UAS-mCD8-GFP stocks were from the Bloomington Drosophila Stock Center. Expression of human APP695 with YFP-Rab5.WT, -CA, or -DN was achieved by crossing these UAS lines to the pan-neuronal GAL4 driver Appl-GAL4 (95). Male UAS human APP695 and Rab5WT, -CA, and -DN or mDC8-GFP were first crossed to APPL-GAL4;B3/Pin virgin females. Males that were ApplGAL4/Y;APP695 or YFP-Rab5 (WT, CA, DN)/B3 were crossed to YFP-Rab5 (WT, CA, DN), APP695, or mCD8-GFP males, and the female larvae that were non-tubby were dissected for analysis. Tubby female siblings that were Appl-GAL4;YFP-Rab5 (WT, CA, DN)/+ or ApplGal4;mCD8-GFP/+ were used as controls.
Larval preparations, immunofluorescence, and quantification. Third instar larvae were dissected and fixed, and segmental nerve immunostaining was performed as described previously (96). Briefly, larvae were dissected in dissection buffer (2× stock containing 128 mM NaCl, 4 mM MgCl2, 2 mM KCl, 5 mM HEPES, and 36 mM sucrose, pH 7.2), fixed in 4% formaldehyde, and incubated overnight with anti-CSP (1:10, Developmental Studies Hybridoma Bank at the University of Iowa). Following incubation in secondary antibodies (Alexa Fluor 568–anti-mouse, A-11004, 1:100, Invitrogen), larvae were mounted using VECTASHIELD mounting medium (Vector Laboratories). Images were collected using a Nikon T2200 fluorescence microscope and analyzed with MetaMorph (Molecular Devices) (95, 96). Quantification of blockages was carried out on collected images using ImageJ as described previously (96). For each genotype, images were collected from 5–9 larvae along their entire body length. Using the threshold, density slice, and particle analysis functions in ImageJ, we quantified and analyzed axonal blockages as described previously (95).
Statistics. All experiments were repeated at least 3 times independently. To quantitate the size of endosomes, we counted 20–30 cells each time. Data represent mean ± SEM. Statistical analyses and calculation of P values were performed using Prism5 (GraphPad Software); Student’s t test was used for pairwise comparisons and 1-way ANOVA for multiple comparisons. P values less than 0.05 were considered statistically significant, and P values less than 0.01 were considered statistically highly significant.
Study approval. All experimental protocols involving the use of animals were approved by the IACUC of UCSD.
WX, AMW, JAW, FF, XW, YW, MLP, XZ, MS, and CW performed the experiments. SC, SG, JD, WCM, and CW conceived the experimental deigns. WX, JD, WCM, and CW analyzed the data and wrote the manuscript.
We thank Pauline Yue Hu for technical support. The study is support by grants from the NIH (PN2EY016525), LuMind Research Down Syndrome Foundation, Larry L. Hillblom Foundation, Alzheimer’s Association, Thrasher Research Fund, and Tau Consortium to W.C. Mobley and C. Wu; the NIH (NS084386 and NS092024) to S. Gunawardena; and the Ministry of Science and Technology of the People’s Republic of China (2014CB965002, 2012BAI10B03), National Natural Science Foundation of China (81171200), Science and Technology Commission of Shanghai Municipality (13JC1401502, 13140904000), and Shanghai Municipal Education Commission (12ZZ115) to J. Ding, W. Xu, Y. Wu.
Address correspondence to: Jianqing Ding, Shanghai Jiaotong University School of Medicine Ruijin Hospital, Institute of Neurology, 197 Ruijin Er Rd., Building #35, Room #404, Shanghai 200025, China. Phone: 011.86.216.445.7249; E-mail: jqding18@163.com. Or to: William C. Mobley, Department of Neurosciences, University of California, San Diego, CNCB Building, Room 100, 9500 Gilman Drive, La Jolla, California 92093-0752, USA. Phone: 858.534.9434; E-mail: wmobley@ucsd.edu. Or to: Chengbiao Wu, Department of Neurosciences, University of California, San Diego, Medical Teaching Facility, Room 312 MC-0624, 9500 Gilman Drive, La Jolla, California 92093-0624, USA. Phone: 858.534.0996; E-mail: chw049@ucsd.edu.
Conflict of interest: The authors have declared that no conflict of interest exists.
Reference information: J Clin Invest. 2016;126(5):1815–1833. doi:10.1172/JCI82409.