Go to JCI Insight
  • About
  • Editors
  • Consulting Editors
  • For authors
  • Publication ethics
  • Publication alerts by email
  • Advertising
  • Job board
  • Contact
  • Clinical Research and Public Health
  • Current issue
  • Past issues
  • By specialty
    • COVID-19
    • Cardiology
    • Gastroenterology
    • Immunology
    • Metabolism
    • Nephrology
    • Neuroscience
    • Oncology
    • Pulmonology
    • Vascular biology
    • All ...
  • Videos
    • ASCI Milestone Awards
    • Video Abstracts
    • Conversations with Giants in Medicine
  • Reviews
    • View all reviews ...
    • Neurodegeneration (Mar 2026)
    • Clinical innovation and scientific progress in GLP-1 medicine (Nov 2025)
    • Pancreatic Cancer (Jul 2025)
    • Complement Biology and Therapeutics (May 2025)
    • Evolving insights into MASLD and MASH pathogenesis and treatment (Apr 2025)
    • Microbiome in Health and Disease (Feb 2025)
    • Substance Use Disorders (Oct 2024)
    • View all review series ...
  • Viewpoint
  • Collections
    • In-Press Preview
    • Clinical Research and Public Health
    • Research Letters
    • Letters to the Editor
    • Editorials
    • Commentaries
    • Editor's notes
    • Reviews
    • Viewpoints
    • 100th anniversary
    • Top read articles

  • Current issue
  • Past issues
  • Specialties
  • Reviews
  • Review series
  • ASCI Milestone Awards
  • Video Abstracts
  • Conversations with Giants in Medicine
  • In-Press Preview
  • Clinical Research and Public Health
  • Research Letters
  • Letters to the Editor
  • Editorials
  • Commentaries
  • Editor's notes
  • Reviews
  • Viewpoints
  • 100th anniversary
  • Top read articles
  • About
  • Editors
  • Consulting Editors
  • For authors
  • Publication ethics
  • Publication alerts by email
  • Advertising
  • Job board
  • Contact
Top
  • View PDF
  • Download citation information
  • Send a comment
  • Terms of use
  • Standard abbreviations
  • Need help? Email the journal
  • Top
  • Abstract
  • Introduction
  • Methods
  • Results
  • Discussion
  • Acknowledgments
  • Footnotes
  • References
  • Version history
  • Article usage
  • Citations to this article

Advertisement

ArticleImmunology Free access | 10.1172/JCI15409

Increased C5a receptor expression in sepsis

Niels C. Riedemann,1 Ren-Feng Guo,1 Thomas A. Neff,1 Ines J. Laudes,1 Katie A. Keller,1 Vidya J. Sarma,1 Maciej M. Markiewski,2 Dimitrios Mastellos,2 Christoph W. Strey,2 Carl L. Pierson,1 John D. Lambris,2 Firas S. Zetoune,1 and Peter A. Ward1

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Riedemann, N. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Guo, R. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Neff, T. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Laudes, I. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Keller, K. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Sarma, V. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Markiewski, M. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Mastellos, D. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Strey, C. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Pierson, C. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Lambris, J. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Zetoune, F. in: PubMed | Google Scholar

1Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan, USA2 Department of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, USA

Address correspondence to: Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, Michigan 48109-0602, USA. Phone: (734) 763-6384; Fax: (734) 763-4782; E-mail: pward@umich.edu.

Find articles by Ward, P. in: PubMed | Google Scholar

Published July 1, 2002 - More info

Published in Volume 110, Issue 1 on July 1, 2002
J Clin Invest. 2002;110(1):101–108. https://doi.org/10.1172/JCI15409.
© 2002 The American Society for Clinical Investigation
Published July 1, 2002 - Version history
Received: March 7, 2002; Accepted: May 21, 2002
View PDF
Abstract

Excessive production of the complement activation product C5a appears to be harmful during the development of sepsis in rodents. Little is known about the role of the C5a receptor (C5aR) and its presence in different organs during sepsis. Using the cecal ligation/puncture (CLP) model in mice, we show here that C5aR immunoreactivity was strikingly increased in lung, liver, kidney, and heart early in sepsis in both control and neutrophil-depleted mice. C5aR mRNA expression in these organs was also significantly increased during sepsis. Immunohistochemical analysis revealed patterns of increased C5aR expression in parenchymal cells in all four organs following CLP. Mice injected at the start of CLP with a blocking IgG to C5aR (αC5aR) showed dramatically improved survival when compared with animals receiving nonspecific IgG, as did mice injected with αC5a. In αC5aR-treated mice, serum levels of IL-6 and TNF-α and bacterial counts in various organs were significantly reduced during CLP when compared with control CLP animals. These studies demonstrate for the first time that C5aR is upregulated in lung, liver, kidney, and heart during the early phases of sepsis and that blockade of C5aR is highly protective from the lethal outcome of sepsis.

Introduction

In the early phases of sepsis, the complement activation product C5a has been shown to play an important inflammatory role in rodents following cecal ligation and puncture (CLP) or subsequent to infusion of LPS (1–5). Besides its strong chemotactic activity, other effects of C5a are known: release from phagocytic cells of granular enzymes, production in neutrophils of superoxide anion, histamine release from mast cells, vasodilatation, increased vascular permeability, smooth muscle contraction, and induction of thymocyte apoptosis during sepsis (3, 6–10). The responses to C5a are mediated by a pertussis toxin–sensitive G protein–linked seven-transmembrane C5a receptor (C5aR), which belongs to the superfamily of rhodopsin-type receptors (11, 12). Originally, C5aR was considered to be confined to myeloid cells (13). In recent years C5aR has been shown to be present on a variety of cells in many different organs (liver, kidney, lungs, brain) (14–19) and on T cells (20).

Excessive production of C5a during sepsis is associated with “deactivation” of blood neutrophils, resulting in loss of the respiratory burst and incapacitation of the vital oxygen-dependent pathway for killing of phagocytized bacteria (1). Given the importance of C5a during sepsis in rodents, the role of C5aR in sepsis would be predicted to be important, but it has not yet been demonstrated. Furthermore, little is known about the functional importance of C5aR on nonmyeloid cells. Therefore, we investigated C5aR content in lung, liver, kidney, and heart, before and during the early period of sepsis, using in vivo binding studies with 125I-antibody against mouse C5aR, RT-PCR analysis for mRNA of C5aR, and immunohistochemical staining of tissue sections. In addition, we investigated in CLP mice the effects of anti -C5aR (αC5aR) on cytokine content in the serum and on bacterial colony counts in various organs. The data to be presented show that C5aR is markedly upregulated during sepsis and that its blockade dramatically improves survival rates in sepsis, reduces cytokine serum levels, and greatly diminishes bacterial content in organs.

Methods

Peptide synthesis and production of αC5aR antibodies. A 37–amino acid peptide spanning the N-terminus of the mouse C5aR and one extra cysteine (MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDC) was synthesized using an Applied Biosystems (Foster City, California, USA) 430A peptide synthesizer as previously described (21). The peptide was then coupled to keyhole limpet hemocyanin by the glutaraldehyde method and used for the immunization of rabbits and the production of immunoreactive antisera. The anti-peptide specific antibody was purified by affinity chromatography using the synthetic peptide coupled to cyanogen bromide–activated Sepharose 4B (Pharmacia Biotech Inc., Piscataway, New Jersey, USA).

Production of αC5a antibody. The C-terminal end (amino acid residues 58–77) of the rat C5a molecule was chosen as described previously (5). The peptide was coupled to keyhole limpet hemocyanin (see above) and then used for the immunization of goats and the production of antisera. The anti-peptide specific antibody was affinity purified. Its cross-reactivity with recombinant mouse C5a was confirmed in Western blots. Initial in vivo activity of this antibody was confirmed by the finding of reduced IgG immune complex–induced lung injury in mice when compared with control IgG–injected animals (data not shown).

Cloning and expression of mouse C5a. Total RNA was isolated from liver tissue from normal mice using the guanidine isothiocyanate method. The mouse C5a sequence was subcloned into pET 15b expression vector (Novagen, Madison, Wisconsin, USA) using the following primers: 5′-GTG TCG CGA GTC AGC CAT ATG AAC CTG CAT CTC CTA-3′ (sense, NdeI site underlined) and 5′-GTC ACA TCG CGA CAC GGA TCC TCA CCT TCC CAG TTG GAC-3′ (antisense, BamHI site underlined). After expression of mouse C5a in BL21 (DE3) pLysS cells (Novagen), the recombinant protein was purified over a Ni++ column and dialyzed with a tubing system (Pierce Chemical Co., Rockford, Illinois, USA). Biological activity of C5a was confirmed by conducting chemotaxis experiments with mouse neutrophils.

Experimental CLP-induced sepsis and organ preparation. Seven- or eight-week-old specific pathogen–free male BALB/c mice (The Jackson Laboratory, Bar Harbor, Maine, USA) were used for all studies. Anesthesia was achieved by intraperitoneal injection of a Ketamine/Xylazine/Dulbecco’s phosphate-buffered saline (DPBS) solution (11 μl/g body weight), for which 1 ml of Ketamine containing 9% Xylazine was diluted with 7 ml of DPBS. In the CLP model, approximately two-thirds of the cecum was ligated through a 1.5-cm abdominal midline incision. The ligated part of the cecum was punctured through and through with a 21-gauge needle. After repositioning of the bowel, the abdomen was closed in layers, using a 4.0 surgical suture (Ethicon Inc., Somerville, New Jersey, USA) and metallic clips. Sham-operated animals underwent the same procedure without ligation or puncture of the cecum. For animal sacrifice, the inferior vena cava was incised and approximately 600 μl blood withdrawn. The chest was then opened, and the pulmonary artery was slowly perfused with 40 ml DPBS, the perfusion liquid being allowed to leak out of the open inferior vena cava after perfusion. Perfusion quality was optically controlled by observing the organ color change (to white) as the blood was completely removed. Thereafter, organs were removed for radioactivity analysis or snap-frozen for RT-PCR experiments and immunohistochemical staining. In lungs, bronchoalveolar lavage was also performed with a total volume of 3 ml.

In vivo binding studies. Polyclonal rabbit anti–mouse C5aR IgG that was affinity-purified or whole rabbit IgG (Jackson ImmunoResearch Laboratories Inc., West Grove, Pennsylvania, USA) was labeled with 125I, using the chloramine method, as described elsewhere (22). This protocol allowed gentle oxidation. The same method was used for labeling of recombinant mouse C5a. For the binding studies, sepsis was induced via CLP, and animals were sacrificed 3, 6, and 12 hours thereafter. Organ radioactivity was compared to that in sham-operated control animals. One hundred nanograms of 125I-labeled anti–mouse C5aR IgG (125I-αC5aR) together with 2 μg nonlabeled antibody as carrier in a total volume of 200 μl DPBS was administered intravenously 15 minutes before sacrifice of the animals. For binding studies with 125I-labeled mouse C5a, 100 ng of 125I-C5a together with 2 μg nonlabeled C5a in 200 μl DPBS was injected intravenously 10 minutes before sacrificing the animals. Two hundred microliters of blood were drawn from the abdominal caval vein to determine the amount of radioactivity in the blood 15 minutes after injection of 125I-αC5aR and 10 minutes after injection of 125I-C5a. Organs were then thoroughly flushed with DPBS and then harvested (as described above) and weighed. Radioactivity was measured in a gamma counter (1261 Multi-γ; Wallac Co., Gaithersburg, Maryland, USA). Data were expressed as cpm per g tissue, divided by the cpm in 100 μl blood sample for each individual animal. Similar experiments were conducted, using neutrophil-depleted mice as controls. Neutrophil depletion was achieved using intraperitoneal injection of rabbit anti–mouse polymorphonuclear neutrophil IgG (Accurate Chemical & Scientific Corp., Westbury, New York, USA) 18 hours before induction of CLP, according to the manufacturer’s instructions.

Isolation of mouse neutrophils and in vitro binding studies. For isolation of neutrophils, 8-week-old BALB/c mice were injected intraperitoneally with 3 ml of 2.4% thioglycollate solution (Difco Laboratories, Detroit, Michigan, USA) for 5 hours. Mice were then sacrificed, and a 1-cm2 patch of skin was dissected from the abdominal muscles. 3 × 10 ml of DPBS was injected intraperitoneally, and the peritoneal lavage fluid was collected and kept at 4°C. Neutrophils were then counted using a light microscope, spun down at 700 g for 10 minutes, and suspended in HBSS containing 1% BSA (Sigma Chemical Co., St. Louis, Missouri, USA) for 40 minutes to block unspecific binding. Neutrophils were then spun down and suspended in binding buffer (HBSS, 0.1% BSA) at a final concentration of 2 × 107 cells/ml and incubated for 20 minutes with whole rabbit IgG (control) or αC5aR. Two hundred microliters of the cell suspensions were then incubated at 4°C for 20 minutes in the presence of 125I-C5a (specific activity of 30–40 μCi/μg). Afterwards, the cell suspension was layered over 20% sucrose and sedimented by centrifugation (11,000 g) in a swinging bucket rotor for 2 minutes. After centrifugation, the tubes were frozen at –80°C and the tips (containing the cell pellets) were cut off to determine the cell-bound 125I-C5a, using a gamma counter (1261 Multi-γ; Wallac Co.). Results were then expressed as cpm, as a function of the concentration of 125I-C5a, in order to establish the saturation curve.

RNA isolation and detection of C5aR mRNA by semiquantitative RT-PCR. Organs from mice were obtained 0, 3, 6, and 12 hours after induction of CLP and prepared as described above. Total RNA was isolated with the Trizol method (Life Technologies Inc., Rockville, Maryland, USA) according to the manufacturer’s instructions. Digestion of any contaminating DNA was achieved by treatment of samples with RQ1 RNase-Free DNase (Promega Corp., Madison, Wisconsin, USA).

Reverse transcription was performed with 5 μg RNA using the Superscript II RNase H– Reverse Transcriptase (GIBCO BRL; Life Technologies Inc., Grand Island, New York, USA) according to the manufacturer’s protocol. PCR was then performed with primers for C5aR: 5′ primer, 5′-TAT AGT CCT GCC CTC GCT CAT-3′; and 3′ primer, 5′-TCA CCA CTT TGA GCG TCT TGG-3′. The primers were designed for a 409-bp cDNA amplification in the middle region of the rat C5aR cDNA (positions 373–781). The primers for the “housekeeping” gene GAPDH were: 5′ primer, 5′-GCC TCG TCT CAT AGA CAA GAT G-3′; and 3′ primer, 5′-CAG TAG ACT CCA CGA CAT AC-3′. After a “hot-start” for 5 minutes at 94°C, 35 cycles were used for amplification with a melting temperature of 94°C, an annealing temperature of 60°C, and an extending temperature of 72°C, each for 1 minute, followed by a final extension at 72°C for 8 minutes. The RT-PCR product was confirmed by electrophoresis of samples in 1.2% agarose gel. Control experiments were performed with the samples; in these experiments we refrained from adding reverse transcriptase, in order to rule out contaminating DNA being responsible for any results. PCR was performed using different cycle numbers for C5aR and GAPDH primers, to assure that DNA was detected within the linear part of the amplifying curves for both primers. Results were presented in a semiquantitative manner.

Immunohistochemical staining for C5aR. Organs from mice were flushed and harvested as described above at 0, 6, and 12 hours after CLP and snap-frozen in liquid nitrogen. For the lungs, bronchoalveolar lavage was performed as indicated, and the lungs were then inflated with 0.8 ml of tissue-embedding solution (Tissue-Tek OCT compound; Fisher Scientific Co., Pittsburgh, Pennsylvania, USA) before freezing to prevent alveolar collapse. Six-micrometer tissue sections were first washed with PBS for 10 seconds and then fixed in methanol for 6 minutes. Next, the tissue sections were washed again in DPBS for 30 seconds and then incubated with αC5aR IgG in a dilution of 1:100 of the stock (0.5 mg/ml) in PBS for 2 hours. Thereafter, the tissue sections were washed for 2 minutes with DPBS before incubation with a 1:500 diluted peroxidase-conjugated goat anti-rabbit IgG for 30 minutes (Jackson ImmunoResearch Laboratories Inc.). After washing with PBS for 2 minutes, the sections were stained using the AEC vector staining kit (Vector Laboratories Inc., Burlingame, California, USA). Counterstaining was achieved with hematoxylin for 30 seconds. Tissue sections were fixed and cover slides were mounted with Permount medium (Fisher Scientific Co.). Staining was documented using light microscopy and digital imaging.

Detection of IL-6 and TNF-α in mouse serum by ELISA. Blood was drawn from αC5aR and control IgG–injected mice at 6 and 18 hours after CLP and was allowed to clot on ice for 2 hours before serum was obtained by centrifugation. Serum samples were then analyzed for IL-6 and TNF-α content using ELISA kits (BioSource International Inc., Camarillo, California, USA) according to the manufacturer’s instructions.

Bacterial counts in organs from CLP animals. Eighteen hours after CLP, lungs, livers, and kidneys were isolated from αC5aR and control IgG–injected mice. Five milliliters 70% ethanol was injected in the peritoneal cavity and left for 1.5 minutes prior to organ removal. Afterward, the liver, kidneys, and lungs were excised in a sterile manner and washed in a 70% ethanol bath for 20 seconds to avoid surface bacterial contamination. Each organ was then manually homogenized in 3 ml sterile 0.9% NaCl. Then, 2 ml of enriched brain-heart infusion was added. Samples were then plated on 5% sheep blood agar or anaerobic blood agar and incubated for 48 hours at 35°C under aerobic and anaerobic conditions. CFUs were then determined in all plates and multiplied by the dilution factor. Data are presented as CFUs per 100 μl of nondiluted tissue homogenate.

Results

Increased in vivo organ binding of 125I-αC5aR during CLP-induced sepsis. To evaluate changes in C5aR expression during sepsis, 125I-αC5aR (1.6 μCi) was injected intravenously into mice 0, 3, 6, and 12 hours after CLP and 15 minutes before sacrificing the animals. The antibody concentration was based on results from preliminary experiments (data not shown). For control animals, an equivalent amount of 125I–normal rabbit IgG (125I-IgG) was administered 0, 6, and 12 hours after CLP as described above. Figure 1 summarizes the results of the binding studies. Figure 1a shows the results of 125I-αC5aR binding in lung, liver, kidney, and heart at the various time points after CLP. In each of the organs, 125I-αC5aR binding was significantly increased in the early phases of sepsis (3 and 6 hours) when compared with the values from animals obtained at time 0. In lungs, a steep increase in binding of 125I-αC5aR occurred 6 hours after CLP; by 12 hours the increase was clearly reduced. In liver and kidney, significantly increased binding occurred by 3 hours, with peak binding at 6 hours. In heart, there was a continuous increase in 125I-αC5aR binding up to 12 hours after induction of CLP. Figure 1b shows binding results from 125I-IgG–injected mice. No significant changes in 125I-IgG binding in any organ could be observed 6 and 12 hours after CLP when compared with binding at 0 hours. Interestingly, in heart, 125I-IgG binding seemed to be slightly decreased 6 and 12 hours after CLP, when compared with the 0-hour control groups.

(a) In vivo binding of 125I-αC5aR to organs 0, 3, 6, and 12 hours after CLPFigure 1

(a) In vivo binding of 125I-αC5aR to organs 0, 3, 6, and 12 hours after CLP. Binding is expressed as the ratio of cpm per g organ to cpm in 100 μl blood from each animal, obtained 15 minutes after intravenous injection of 125I-αC5aR. (b) In vivo binding of 125I-labeled rabbit IgG to similar organs expressed similarly to the data in a. Data are representative of three to six animals for each time point. *Statistical significance in treated groups when compared with control animals.

Even though organs were extensively flushed to remove residual blood, we also conducted experiments in neutrophil-depleted animals at 0 and 6 hours after CLP in order to assess whether intravascular neutrophils were responsible for the observed increase in in vivo binding of 125I-αC5aR. Figure 2 demonstrates significantly increased 125I-αC5aR binding in all four organs in neutrophil-depleted mice 6 hours after CLP. The increase was comparable to that found in liver, kidney, and heart in neutrophil-intact mice. In lungs, the increase in binding was less prominent in neutrophil-depleted CLP mice, when compared with neutrophil-intact animals. Accordingly, it is possible in the lung that full C5aR upregulation is dependent on neutrophil presence.

In vivo binding of 125I-αC5aR to various organs in neutrophil-depleted miceFigure 2

In vivo binding of 125I-αC5aR to various organs in neutrophil-depleted mice 0 and 6 hours after CLP. Binding is expressed as the ratio of cpm per g organ to cpm in 100 μl blood from each animal, obtained 15 minutes after intravenous injection of 125I-αC5aR. *Statistical significance in treated groups when compared with control animals. Data are representative of four to seven animals per group. PMN, polymorphonuclear neutrophil.

Inhibition of 125I-C5a binding by αC5aR. Binding experiments with 125I–mouse C5a were conducted in vitro and in vivo to assess the effects of αC5aR to reduce binding of C5a. Figure 3 summarizes the results of these experiments. In Figure 3a, peritoneal mouse neutrophils were isolated and preincubated with either irrelevant rabbit IgG as control or αC5aR IgG (1 or 10 μg) for 20 minutes. Afterward, binding of 1 nM 125I–mouse C5a occurred for 20 minutes in the presence of the IgG preparations. A significant inhibition (60–73%) of binding was found with αC5aR as a function of the amount of αC5aR present. The amount of unspecific binding was assessed in the presence of 100-fold excess of nonlabeled C5a and measured with approximately 60 cpm (subtracted in the y axes). To further confirm inhibition of 125I-C5a binding by αC5aR, we conducted binding experiments in mice in vivo, 6 hours after CLP (Figure 3b). To block the binding of 125I-C5a, αC5aR was administered (as described above) 15 minutes in advance of the infusion of 125I-C5a. 125I-C5a was then injected intravenously 10 minutes before sacrificing the animals. A prominent inhibition of 125I-C5a binding was found in all four organs but did not reach statistical significant in lungs (n = 4). The results in Figure 3 demonstrate that αC5aR inhibits 125I-C5a binding significantly in vitro and in vivo.

Inhibition of binding of 125I-labeled mouse C5a (125I-C5a) to peritoneal moFigure 3

Inhibition of binding of 125I-labeled mouse C5a (125I-C5a) to peritoneal mouse neutrophils in vitro (a) and various organs in vivo (b) by αC5aR. (a) Binding of 125I-C5a is expressed as cpm. Groups were treated (as indicated) for 20 minutes prior to binding of 125I-C5a. Data are representative of five independent experiments per condition. (b) Binding of 125I-C5a is expressed as the ratio of cpm per g organ to cpm in 100 μl blood from each animal (n = 4 per condition) obtained 10 minutes after intravenous injection of 125I-C5a and 6 hours after CLP. αC5aR (6 μg/mouse) or an equal amount of irrelevant rabbit IgG (control) was administered intravenously 15 minutes prior to 125I-C5a infusion. *Statistical significance in treated groups when compared with control animals. Ctrl, control.

Increased expression of mRNA for C5aR during CLP-induced sepsis in mice. To further extend the results from the in vivo binding experiments, we conducted RT-PCR experiments. Figure 4 summarizes the results of these experiments. In each of the four organs studied, there was an increase in the amount of mRNA for C5aR during the onset of CLP-induced sepsis, roughly correlating with increased organ binding of 125I-αC5aR (Figure 1). In the lung, an increase in mRNA for C5aR in the semiquantitative RT-PCR was observed 6 hours after CLP (but not at 3 hours). In liver, kidney, and heart, increased levels of C5aR mRNA could be observed as early as 3 hours after onset of CLP. In liver, lung, and heart, the peak increase in C5aR mRNA expression occurred 6 hours after CLP, while in kidney a constant increase was found as long as 12 hours after CLP. The RT-PCR experiments suggested an increased gene expression for C5aR early in sepsis, consistent with the observed increase in binding of 125I-αC5aR to the same organs. In data not shown, when small intestine and brain were evaluated 12 hours after CLP for increased binding of 125I-αC5aR or increased content of mRNA for C5aR, no increases were observed, suggesting that changes in C5aR mRNA are not global.

Semiquantitative RT-PCR for C5aR mRNA in lung, liver, kidney, and heart. RTFigure 4

Semiquantitative RT-PCR for C5aR mRNA in lung, liver, kidney, and heart. RT-PCR was performed using RNA isolated 0, 3, 6, and 12 hours after CLP. Approximately equal loading of the DNA product is demonstrated by expression of GAPDH mRNA (lower half of each panel). Results are representative of two independent and separate experiments for each group and time point.

Immunohistochemical staining of lung, liver, kidney, and heart during sepsis. Based on the evidence of increased mRNA expression for C5aR and increased 125I-αC5aR in vivo binding, we performed immunohistochemical staining of organs to address the question of where in the tissues increased C5aR protein expression could be found. Figure 5 demonstrates immunohistochemical staining results in sections from lung, liver, kidney and heart obtained from control mice and CLP mice at 12 hours. In the lung, results revealed patterns of staining mainly in the bronchiolar epithelial cells. In liver, diffuse staining of the hepatocytes and sinusoidal cells was observed in contrast to staining of tissues in control mice. In the kidneys, CLP resulted in dramatically increased staining for C5aR protein in proximal and distal tubular epithelial cells, but not in glomeruli. In the heart, 12 hours after CLP there was diffuse staining of myocytes. Accordingly, CLP causes a clear expression of C5aR protein in organs in which we had already shown that mRNA for C5aR and binding of 125I-αC5aR were increased.

Immunohistochemical stains of organ sections for C5aR from mice, as indicatFigure 5

Immunohistochemical stains of organ sections for C5aR from mice, as indicated in the text. Compared are staining results from organ sections from control animals (left panels) and from animals 12 hours after CLP (right panels). Results are representative of three to six stainings from two independent experiments per condition. Magnification, ×20; insets in right panels, ×40 (hematoxylin staining).

Effects of αC5aR or αC5a IgG treatment in CLP mice. To investigate the roles of αC5aR and αC5a on survival rates in CLP-induced sepsis in mice, 20 μg αC5aR IgG or αC5a were injected intravenously in a volume of 200 μl DPBS into mice directly after induction of CLP, and, in the case of αC5aR, also at 6 hours after CLP. In parallel, other CLP mice were given the same amount of normal rabbit IgG. Figure 6 demonstrates the results of this survival study. In the first 24 hours after induction of sepsis, in the group treated with anti–mouse C5a, only a single mouse died. The overall survival was 70% at day 7. In CLP mice treated with αC5aR at the start of CLP, 24% of the animals died within the first 3 days. From this point onward, there were no additional deaths, with a 7-day overall survival of 76%. In the CLP group treated with normal rabbit IgG, the survival curve dropped dramatically in the first 72 hours after CLP, revealing an overall survival of 0% by day 5. In the CLP group receiving αC5aR 6 hours after CLP, no beneficial effect could be observed, and all animals died, as in the control IgG–injected group. Therefore, treatment with αC5a or αC5aR antibody at the start of CLP dramatically increases the survival rate, suggesting the importance of C5a and C5aR in the lethal outcomes of CLP-induced sepsis in mice.

Survival study in CLP mice over 7 days. Mice were treated intravenously witFigure 6

Survival study in CLP mice over 7 days. Mice were treated intravenously with 20 μg αC5aR (n = 11), 20 μg αC5a (n = 10), or 20 μg rabbit IgG (n = 12), each being infused at the time of CLP. In another experiment, 20 μg αC5aR (n = 10) was injected 6 hours after CLP.

Effects of αC5aR antibody treatment on serum IL-6 and TNF-α levels and organ content of bacteria. To determine possible mechanisms responsible for the observed beneficial effects of αC5aR treatment in septic mice, we measured IL-6 and TNF-α serum levels in serum samples obtained 6 and 18 hours after CLP. Figure 7a summarizes the results, demonstrating significantly reduced IL-6 levels at 6 and 18 hours and greatly reduced TNF-α levels 18 hours after CLP in αC5aR-treated animals, when compared with control IgG–injected mice. At 6 hours after CLP, none of the animals showed detectable TNF-α serum levels. These data suggest a significant linkage between C5aR and serum levels of two cytokines that are negatively correlated with survival in sepsis. Since αC5aR significantly improved survival in CLP mice, we investigated bacterial CFUs in lung, liver, and kidney 18 hours after CLP. Figure 7b demonstrates a significant reduction of aerobic bacterial counts in lungs and kidneys in the αC5aR-injected group when compared with control IgG–injected animals. In liver there was a similar tendency, but the error bars prevented statistical significance. This may be due to the liver being directly exposed to bacterial peritonitis of CLP. Bacterial counts for anaerobic cultures in the various organs showed patterns similar to those of the aerobic ones (data not shown).

(a) ELISA measurements for IL-6 and TNF-α serum levels at 6 and 18 hours afFigure 7

(a) ELISA measurements for IL-6 and TNF-α serum levels at 6 and 18 hours after CLP-induced sepsis and in healthy control mice (normal). When used, αC5aR treatment consisted of 20 μg/mouse at the start of CLP, with a companion group treated with control IgG (20 μg/mouse). (b) Content of aerobic bacteria in lung, liver, and kidney 18 hours after CLP-induced sepsis in mice. Compared groups were treated as described for a (n = 4 for all groups). *Statistically significant changes between αC5aR- and control IgG–treated CLP groups.

Discussion

As mentioned above, C5a has been considered to be a harmful mediator during sepsis, presumably because of excessive production (1–5). Only recently as new blocking agents have become available (antibodies to C5aR or antagonists to C5aR), more attention has been paid to the potential role of C5aR in various organs (14, 16, 23–25). C5a is responsible for a broad variety of effects in different tissues, as described above. Unless levels of C5a are rigorously regulated in vivo, the effects of C5a may be harmful during the inflammatory response. The presence and the expression of C5aR in organs has become an important focus.

Recently it has been shown that C5aR expression in the brain is increased following closed head injury (26). Immune complex–induced injury and tissue damage following ischemia/reperfusion have been reported to be attenuated by a C5aR antagonist (C5aRa) (27). Another C5aRa compound inhibits the reversed passive Arthus reaction in skin as well as endotoxic shock in rats (28, 29). In an experimental model of asthma and after airway instillation of LPS, C5aR and C3aR have been shown to be upregulated on bronchial epithelial cells and on smooth muscle cells of the airways (30). We were interested in evaluating C5aR expression in various organs during the development of sepsis in mice, since our recent work suggests in CLP rats that C5a is linked to adverse consequences (multiorgan failure and death), presumably related to interactions of C5a with C5aR. Besides lung, liver, kidney, and heart, we also investigated intestine, thyroid gland, and brain. In the latter three organs, no evidence of increased mRNA expression for C5aR or in vivo binding of αC5aR IgG was found (data not shown) during the onset of sepsis. Therefore, we decided to focus on changes in lung, liver, kidney, and heart after CLP. We demonstrated increased in vivo binding of αC5aR and accompanying increased expression of mRNA for C5aR in these four organs after CLP-induced sepsis. In addition, immunohistochemical staining demonstrated that C5aR was upregulated in bronchiolar epithelial cells and small vessels, hepatocytes, tubular epithelial cells of the kidney, and myocytes in the heart.

We have recently reported that C5a binding to blood neutrophils in CLP rats is decreased and that the binding activity can be greatly improved by αC5a treatment (4), suggesting development of decreased surface C5aR on rat neutrophils during sepsis. Therefore, the question arises as to whether C5aR on blood neutrophils during sepsis may be regulated differently from that demonstrated for the different organs in which increased binding of αC5aR was found in this study. The internalization of C5a • C5aR complexes on the surfaces of phagocytic cells is well known. We are currently investigating C5aR content on neutrophils during sepsis in rats. Preliminary data indicate the loss of C5aR on blood neutrophils after CLP (N.C. Riedemann et al., unpublished data), suggesting that C5aR on blood neutrophils may be regulated differently from C5aR in solid organs during sepsis. Our data suggest that C5aR protein and mRNA are both upregulated in organs during sepsis. An additional possibility is that C5aR, during sepsis, undergoes a conformational change, which enhances its affinity for the antibody, but there is no direct evidence to support this possibility.

Even though treatment with antibodies to C5a greatly increases survival in CLP-induced sepsis in rats (1), blockade of the C5aR with specific antibody has not been previously assessed in experimental sepsis. The results with treatment of CLP mice with αC5aR IgG demonstrated markedly improved survival when mice were injected with αC5aR immediately after CLP. Delayed infusion (until 6 hours of sepsis) of αC5aR did not result in a beneficial outcome in sepsis, perhaps because of early increases in C5aR in various organs. Our results demonstrate the dramatic effects of αC5aR treatment on serum levels of IL-6 and TNF-α during sepsis (Figure 7a) and on bacterial CFU content in various organs (Figure 7b). These data suggest that blockade of C5aR greatly attenuates the cytokine response. High IL-6 serum levels have been demonstrated to be predictive of poor outcomes in septic patients (31–33). The results in Figure 7b also suggest that beneficial effects of αC5aR treatment (reduced organ CFUs) may be explained by enhanced bacterial clearance, perhaps due to preservation of the neutrophil oxidative burst as in CLP rats treated with αC5a (4). It is also possible that sepsis-induced upregulation of C5aR in organs renders these organs susceptible to harmful effects after contact with C5a, although this remains to be shown.

The biological significance of increased C5aR expression in different organs during sepsis remains to be defined. It might be noted that in CLP in rats, the liver, lungs, and kidneys become targets for development of multiorgan failure, and that interception of C5a with αC5a greatly improves survival and dramatically reduces the intensity of multiorgan failure (1, 4). We have recently found that C5aR expression after CLP is increased in the rat thymus and is correlated with increased binding of C5a and induction of apoptosis (34).

The results of the current studies indicate that C5aR expression is increased in lung, liver, kidney, and heart during CLP-induced sepsis in mice at the protein level as well as at the transcriptional level. Our results underscore the importance of increased C5aR expression during sepsis by demonstrating a significantly improved survival in CLP mice after C5aR blockade or with αC5a. The functional relevance of increased C5aR expression in different organs during sepsis remains to be determined. Our findings suggest that the further investigation of compounds that intercept C5a or interfere with its ability to bind to C5aR is warranted.

Acknowledgments

This paper was supported by the following NIH National Heart, Lung, and Blood Institute grants: GM-29507, HL-31963, GM-61656, and GM-62134.

Footnotes

Conflict of interest: No conflict of interest has been declared.

Nonstandard abbreviations used: C5a receptor (C5aR); cecal ligation/puncture (CLP); anti-C5aR (αC5aR); Dulbecco’s phosphate-buffered saline (DPBS); C5aR antagonist (C5aRa); 125I-labeled anti–mouse C5aR IgG (125I-αC5aR).

References
  1. Czermak, BJ, et al. Protective effects of C5a blockade in sepsis. Nat Med 1999. 5:788-792.
    View this article via: PubMed CrossRef Google Scholar
  2. Smedegard, G, Cui, LX, Hugli, TE. Endotoxin-induced shock in the rat. A role for C5a. Am J Pathol 1989. 135:489-497.
    View this article via: PubMed Google Scholar
  3. Guo, RF, et al. Protective effects of anti-C5a in sepsis-induced thymocyte apoptosis. J Clin Invest 2000. 106:1271-1280.
    View this article via: JCI PubMed CrossRef Google Scholar
  4. Huber-Lang, M, et al. Role of C5a in multiorgan failure during sepsis. J Immunol 2001. 166:1193-1199.
    View this article via: PubMed Google Scholar
  5. Huber-Lang, MS, et al. Protective effects of anti-C5a peptide antibodies in experimental sepsis. FASEB J 2001. 15:568-570.
    View this article via: PubMed Google Scholar
  6. Cochrane, CG, Muller-Eberhard, HJ. The derivation of two distinct anaphylatoxin activities from the third and fifth components of human complement. J Exp Med 1968. 127:371-386.
    View this article via: PubMed CrossRef Google Scholar
  7. Goldstein, IM, Weissmann, G. Generation of C5-derived lysosomal enzyme-releasing activity (C5a) by lysates of leukocyte lysosomes. J Immunol 1974. 113:1583-1588.
    View this article via: PubMed Google Scholar
  8. Sacks, T, Moldow, CF, Craddock, PR, Bowers, TK, Jacob, HS. Oxygen radicals mediate endothelial cell damage by complement-stimulated granulocytes. An in vitro model of immune vascular damage. J Clin Invest 1978. 61:1161-1167.
    View this article via: JCI PubMed CrossRef Google Scholar
  9. Schumacher, WA, Fantone, JC, Kunkel, SE, Webb, RC, Lucchesi, BR. The anaphylatoxins C3a and C5a are vasodilators in the canine coronary vasculature in vitro and in vivo. Agents Actions 1991. 34:345-349.
    View this article via: PubMed CrossRef Google Scholar
  10. Shin, HS, Snyderman, R, Friedman, E, Mellors, A, Mayer, MM. Chemotactic and anaphylatoxic fragment cleaved from the fifth component of guinea pig complement. Science 1968. 162:361-363.
    View this article via: PubMed CrossRef Google Scholar
  11. Gerard, NP, Hodges, MK, Drazen, JM, Weller, PF, Gerard, C. Characterization of a receptor for C5a anaphylatoxin on human eosinophils. J Biol Chem 1989. 264:1760-1766.
    View this article via: PubMed Google Scholar
  12. Gerard, NP, Gerard, C. The chemotactic receptor for human C5a anaphylatoxin. Nature 1991. 349:614-617.
    View this article via: PubMed CrossRef Google Scholar
  13. Chenoweth, DE, Hugli, TE. Demonstration of specific C5a receptor on intact human polymorphonuclear leukocytes. Proc Natl Acad Sci USA 1978. 75:3943-3947.
    View this article via: PubMed CrossRef Google Scholar
  14. Zwirner, J, Fayyazi, A, Gotze, O. Expression of the anaphylatoxin C5a receptor in non-myeloid cells. Mol Immunol 1999. 36:877-884.
    View this article via: PubMed CrossRef Google Scholar
  15. Haviland, DL, et al. Cellular expression of the C5a anaphylatoxin receptor (C5aR): demonstration of C5aR on nonmyeloid cells of the liver and lung. J Immunol 1995. 154:1861-1869.
    View this article via: PubMed Google Scholar
  16. Floreani, AA, et al. Expression of receptors for C5a anaphylatoxin (CD88) on human bronchial epithelial cells: enhancement of C5a-mediated release of IL-8 upon exposure to cigarette smoke. J Immunol 1998. 160:5073-5081.
    View this article via: PubMed Google Scholar
  17. Schieferdecker, HL, Schlaf, G, Koleva, M, Gotze, O, Jungermann, K. Induction of functional anaphylatoxin C5a receptors on hepatocytes by in vivo treatment of rats with IL-6. J Immunol 2000. 164:5453-5458.
    View this article via: PubMed Google Scholar
  18. Wetsel, RA. Expression of the complement C5a anaphylatoxin receptor (C5aR) on non-myeloid cells. Immunol Lett 1995. 44:183-187.
    View this article via: PubMed CrossRef Google Scholar
  19. Gasque, P, Singhrao, SK, Neal, JW, Gotze, O, Morgan, BP. Expression of the receptor for complement C5a (CD88) is up-regulated on reactive astrocytes, microglia, and endothelial cells in the inflamed human central nervous system. Am J Pathol 1997. 150:31-41.
    View this article via: PubMed Google Scholar
  20. Nataf, S, Davoust, N, Ames, RS, Barnum, SR. Human T cells express the C5a receptor and are chemoattracted to C5a. J Immunol 1999. 162:4018-4023.
    View this article via: PubMed Google Scholar
  21. Becherer, JD, Lambris, JD. Identification of the C3b receptor-binding domain in third component of complement. J Biol Chem 1988. 263:14586-14591.
    View this article via: PubMed Google Scholar
  22. Bennett, GL, Horuk, R. Iodination of chemokines for use in receptor binding analysis. Methods Enzymol 1997. 288:134-148.
    View this article via: PubMed CrossRef Google Scholar
  23. Osaka, H, et al. Expression of C5a receptor in mouse brain: role in signal transduction and neurodegeneration. Neuroscience 1999. 88:1073-1082.
    View this article via: PubMed CrossRef Google Scholar
  24. Rothermel, E, Gotze, O, Zahn, S, Schlaf, G. Analysis of the tissue distribution of the rat C5a receptor and inhibition of C5a-mediated effects through the use of two MoAbs. Scand J Immunol 2000. 52:401-410.
    View this article via: PubMed CrossRef Google Scholar
  25. Zahedi, R, et al. The C5a receptor is expressed by human renal proximal tubular epithelial cells. Clin Exp Immunol 2000. 121:226-233.
    View this article via: PubMed CrossRef Google Scholar
  26. Stahel, PF, et al. Intracerebral complement C5a receptor (CD88) expression is regulated by TNF and lymphotoxin-alpha following closed head injury in mice. J Neuroimmunol 2000. 109:164-172.
    View this article via: PubMed CrossRef Google Scholar
  27. Heller, T, et al. Selection of a C5a receptor antagonist from phage libraries attenuating the inflammatory response in immune complex disease and ischemia/reperfusion injury. J Immunol 1999. 163:985-994.
    View this article via: PubMed Google Scholar
  28. Strachan, AJ, Woodruff, TM, Haaima, G, Fairlie, DP, Taylor, SM. A new small molecule C5a receptor antagonist inhibits the reverse-passive Arthus reaction and endotoxic shock in rats. J Immunol 2000. 164:6560-6565.
    View this article via: PubMed Google Scholar
  29. Strachan, AJ, Shiels, IA, Reid, RC, Fairlie, DP, Taylor, SM. Inhibition of immune-complex mediated dermal inflammation in rats following either oral or topical administration of a small molecule C5a receptor antagonist. Br J Pharmacol 2001. 134:1778-1786.
    View this article via: PubMed CrossRef Google Scholar
  30. Drouin, SM, et al. Expression of the complement anaphylatoxin C3a and C5a receptors on bronchial epithelial and smooth muscle cells in models of sepsis and asthma. J Immunol 2001. 166:2025-2032.
    View this article via: PubMed Google Scholar
  31. Calandra, T, Gerain, J, Heumann, D, Baumgartner, JD, Glauser, MP. High circulating levels of interleukin-6 in patients with septic shock: evolution during sepsis, prognostic value, and interplay with other cytokines. The Swiss-Dutch J5 Immunoglobulin Study Group. Am J Med 1991. 91:23-29.
    View this article via: PubMed CrossRef Google Scholar
  32. Casey, LC, Balk, RA, Bone, RC. Plasma cytokine and endotoxin levels correlate with survival in patients with the sepsis syndrome. Ann Intern Med 1993. 119:771-778.
    View this article via: PubMed Google Scholar
  33. Damas, P, et al. Cytokine serum level during severe sepsis in human IL-6 as a marker of severity. Ann Surg 1992. 215:356-362.
    View this article via: PubMed Google Scholar
  34. Riedemann, NC, et al. C5a receptor and thymocyte apoptosis in sepsis. FASEB J 2002. 16:887-888. doi:10.1096/fj.02–0033fje.
    View this article via: PubMed Google Scholar
Version history
  • Version 1 (July 1, 2002): No description

Article tools

  • View PDF
  • Download citation information
  • Send a comment
  • Terms of use
  • Standard abbreviations
  • Need help? Email the journal

Metrics

  • Article usage
  • Citations to this article

Go to

  • Top
  • Abstract
  • Introduction
  • Methods
  • Results
  • Discussion
  • Acknowledgments
  • Footnotes
  • References
  • Version history
Advertisement
Advertisement

Copyright © 2026 American Society for Clinical Investigation
ISSN: 0021-9738 (print), 1558-8238 (online)

Sign up for email alerts