Research Article

Clearance of Alzheimer’s amyloid-β1-40 peptide from brain by LDL receptor–related protein-1 at the blood-brain barrier

Masayoshi Shibata1, Shinya Yamada1, S. Ram Kumar1, Miguel Calero2, James Bading3, Blas Frangione2, David M. Holtzman4, Carol A. Miller5, Dudley K. Strickland6, Jorge Ghiso2 and Berislav V. Zlokovic1,7

1Department of Neurological Surgery, Keck School of Medicine of the University of Southern California, Los Angeles, California, USA
2Department of Pathology, New York University Medical Center, New York, New York, USA
3Department of Radiology, Keck School of Medicine of the University of Southern California, Los Angeles, California, USA
4Department of Neurology, Washington University School of Medicine, St. Louis, Missouri, USA
5Department of Pathology, Keck School of Medicine of the University of Southern California, Los Angeles, California, USA
6Department of Vascular Biology, Holland Laboratories, American Red Cross, Rockville, Maryland, USA
7Division of Neurovascular Biology, Center for Aging and Developmental Biology of the University of Rochester Medical School, Rochester, New York, USA

Address correspondence to: Berislav V. Zlokovic, Division of Neurovascular Biology, Aab Institute of Biomedical Sciences, Center for Aging and Developmental Biology, University of Rochester Medical School, 601 Elmwood Avenue, Box 645, Rochester, New York 14642, USA. Phone: (716) 273-3132; Fax: (716) 273-3133; E-mail: Berislav_Zlokovic@urmc.rochester.edu.

Published December 15, 2000
Received for publication June 5, 2000, and accepted in revised form November 6, 2000.

Elimination of amyloid-β peptide (Aβ) from the brain is poorly understood. After intracerebral microinjections in young mice, 125I-Aβ1-40 was rapidly removed from the brain (t1/2 ≤ 25 minutes), mainly by vascular transport across the blood-brain barrier (BBB). The efflux transport system for Aβ1-40 at the BBB was half saturated at 15.3 nM, and the maximal transport capacity was reached between 70 nM and 100 nM. Aβ1-40 clearance was substantially inhibited by the receptor-associated protein, and by antibodies against LDL receptor–related protein-1 (LRP-1) and α2-macroglobulin (α2M). As compared to adult wild-type mice, clearance was significantly reduced in young and old apolipoprotein E (apoE) knockout mice, and in old wild-type mice. There was no evidence that Aβ was metabolized in brain interstitial fluid and degraded to smaller peptide fragments and amino acids before its transport across the BBB into the circulation. LRP-1, although abundant in brain microvessels in young mice, was downregulated in older animals, and this downregulation correlated with regional Aβ accumulation in brains of Alzheimer’s disease (AD) patients. We conclude that the BBB removes Aβ from the brain largely via age-dependent, LRP-1–mediated transport that is influenced by α2M and/or apoE, and may be impaired in AD.

Introduction

Deposition of amyloid-β peptide (Aβ) in the brain occurs during normal aging and is accelerated in patients with Alzheimer’s disease (AD). Aβ is central to the pathology of AD, and is the main constituent of brain parenchymal and vascular amyloid (16). Aβ extracted from senile plaques contains mainly Aβ1-40 and Aβ1-42 (7), whereas vascular amyloid is predominantly Aβ1-39 and Aβ1-40 (8). Several sequences of Aβ were found in both lesions (911). A major soluble form of Aβ, which is present in the blood, cerebrospinal fluid (CSF) (1214), and brain (1516) is Aβ1-40. In the circulation, CSF, and brain interstitial fluid (ISF), soluble Aβ may exist as a free peptide or be associated with different transport binding proteins such as apolipoproteins J (apoJ) (1718) and E (apoE) (19), transthyretin (20), lipoproteins (21), albumin (22), and α2-macroglobulin (α2M) (23).

The neuronal theory argues that soluble brain-derived Aβ is a precursor of Aβ deposits. Neuronal cells secrete Aβ in culture (24), which supports this view. An increase in soluble Aβ in AD and Down syndrome brains precedes amyloid plaque formation (15, 25, 26) and correlates with the development of vascular pathology (27). Several cytosolic proteases that may degrade intracellular Aβ in vitro cannot degrade extracellular Aβ from brain ISF (28) or CSF (29) in vivo. An exception to this is enkephalinase, which may degrade Aβ1-42 from brain ISF (28). However, the physiological importance of this degradation in vivo remains unclear, because the peptide was studied at extremely high pharmacological concentrations (30).

It has been suggested that decreased clearance of Aβ from brain and CSF is the main cause of Aβ accumulation in sporadic AD (31). Because Aβ is continuously produced in the brain, we hypothesized that an efficient clearance mechanism or mechanisms must exist at the blood-brain barrier (BBB) to prevent its accumulation and subsequent aggregation in the brain. Cell-surface receptors such as the receptor for advanced glycation end products (RAGE) (3233), scavenger receptor type A (SR-A) (34), LDL receptor–related protein-1 (LRP-1) (3538), and LRP-2 (39) bind Aβ at low (nanomolar) concentrations as free peptide (RAGE, SR-A) and/or in complex with α2M, apoE, or apoJ (LRP-1, LRP-2). RAGE and SR-A regulate brain endothelial endocytosis and transcytosis of Aβ that is initiated at the luminal side of the BBB (33), whereas LRP-2 mediates BBB transport of plasma Aβ complexed to apoJ (39). The role of vascular receptors and BBB transport in the removal of brain-derived Aβ is unknown.

In this study, we developed a brain tissue clearance technique in mice based on a model used previously in the rabbit (40). This technique was used to determine in vivo the efflux rates of Aβ1-40 from the CNS as a function of time and concentration of peptide, and to characterize vascular transport and/or any receptor-mediated efflux mechanisms involved in elimination of brain-derived Aβ across the BBB. The study focused on LRP-1 and its ligands, α2M and apoE, first because they promote Aβ clearance in smooth muscle cells (35), neurons (36, 38), and fibroblasts (37); and second, because apoE4 is a definite risk factor, and α2M is a possible risk factor for AD (4142).

Methods

Synthetic peptide and radioiodination. Peptide DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Aβ1-40) homologous to residues 672–711 of Aβ-precursor protein 770 was synthesized at the W.M. Keck Facility at Yale University using N-t-butyloxycarbonyl chemistry. The peptide was purified by HPLC. Aliquots of the final products were lyophilized and stored at –20°C until use. Radioiodination was carried out with Na125I and IodoBeads (Pierce Chemical Co., Rockford, Illinois, USA), and the resulting components were resolved by HPLC (39). Aliquots of radiolabeled Aβ1-40 were kept at –20°C for a maximum of 4 weeks before use. The HPLC analysis confirmed that more than 99% of radioactivity was present in the form of nonoxidized monomeric peptide.

Brain clearance model in mice. Experiments were performed on male C57BL/6 wild-type mice, 8–10 weeks old and 9–10 months old, and on male apoE knockout (apoE KO) mice on a C57BL/6 background (Taconic Farms, Germantown, New York, USA) that were also 8–10 weeks old and 9–10 months old. CNS clearance of radiolabeled Aβ1-40 and the inert polar marker inulin was determined as described below (40, 43).

A stainless steel guide cannula was implanted stereotaxically into the right caudate nucleus of mice anesthetized with 60 mg/kg intraperitoneal sodium pentobarbital). Coordinates for the tip of the cannula were 0.9 mm anterior and 1.9 mm lateral to bregma, and 2.9 mm below the surface of the brain. The guide cannula and screw were fixed to the skull with methylmethacrylate (Plastics One Inc., Roanoke, Virginia, USA), and a stylet was introduced into the guide cannula. Animals were observed for 1 week before radiotracer studies.

For radioisotope injection, animals were reanesthetized, and an injector cannula (Plastics One Inc.) was attached to a 10-μl gas-tight microsyringe (Hamilton Co., Reno, Nevada, USA) using 24-gauge Teflon tubing (Small Parts Inc., Miami Lake, Florida, USA). The amount of injected tracer was determined accurately using a micrometer to measure linear displacement of the syringe plunger in the precalibrated microsyringe. Tracer fluid (0.5 μl) containing 125I-Aβ1-40 at concentrations varying from 0.05 nM to 120 nM was injected over a period of 5 minutes, along with [14C]inulin. When the effect of different molecular reagents was tested, those were injected simultaneously with the radiolabeled peptides.

Time response was studied with 125I-Aβ1-40 from 10 minutes to 300 minutes; dose-dependent effects were determined at 30 minutes. The effects of different molecular reagents that may potentially inhibit 125I-Aβ1-40 clearance were studied at 30 minutes. Among the reagents studied was the rabbit anti–human LRP-1 Ab designated R777, which was affinity purified on a Sepharose–LRP-1 heavy-chain column as described (44). R777 immunoprecipitates mouse LRP-1, as we described (44), and blocks LRP-1–mediated uptake of amyloid β precursor protein (APP) and thrombospondin in murine fibroblasts (45, 46). Another studied reagent that may inhibit 125I-Aβ1-40 clearance is receptor-associated protein (RAP; kindly provided by G. Bu, Washington University). We also studied the rabbit anti–mouse α2M Ab designated YNRMA2M, which is specific for mouse α2M as demonstrated by radial immunodiffusion and immunoelectrophoresis (Accurate Chemical & Scientific Corp., Westbury, New York, USA); a rabbit anti–rat gp330 affinity-purified IgG designated Rb6286, which crossreacts with mouse LRP-2 as reported (47) (kindly provided by Scott Argraves, University of South Carolina Medical School, Charleston, South Carolina, USA); a rabbit anti-human RAGE Ab that crossreacts with mouse RAGE (32) (kindly provided by D. Stern, Columbia University, New York, New York, USA), and fucoidin (Sigma Chemical Co., St. Louis, Missouri, USA).

Tissue sampling and radioactivity analysis. Brain, blood, and CSF were sampled and prepared for radioactivity analysis. Degradation of 125I-Aβ1-40 was initially studied by trichloroacetic acid (TCA) precipitation assay. Previous studies with 125I-Aβ1-40 demonstrated an excellent correlation between TCA and HPLC methods (33, 4851). Brain, plasma, and CSF samples were mixed with TCA (final concentration 10%) and centrifuged at 24,840 g at 4°C for 8–10 minutes. Radioactivity in the precipitate, water, and chloroform fractions was determined in a gamma counter (Wallac Finland Oy, Turku, Finland). The 125I-Aβ1-40 injected into the brain was more than 97% intact, according to TCA analysis.

Degradation of 125I-Aβ1-40 in the brain was further studied by HPLC and SDS-PAGE analysis. After intracerebral injections of 125I-Aβ1-40, brain tissue was homogenized in PBS containing protease inhibitors (0.5 mM phenylmethylsulfonyl fluoride, 1 μg/ml leupeptin, and 1 mM p-aminobenzamidine), and then centrifuged at 100,000 g for 1 hour at 4°C. The supernatant was then lyophilized. The resulting material was dissolved in 0.005% trifluoroacetic acid (TFA) in water at pH 2 before injection onto a Vydac C4 column (The Separations Group, Hesperia, California, USA). The separation was achieved with a 30-minute linear gradient of 25–83% acetonitrile in 0.1% TFA at a flow rate of 1 ml/min, as we have described (51). Under these conditions, the Aβ1-40 standard eluted at 14.5 minutes. Column eluants were monitored at 214 nm. The eluted fractions were collected and counted. The 125I-Aβ1-40 injected into the brain was greater than 97% intact according to HPLC analysis, confirming the results of TCA analysis.

For SDS-PAGE analysis, TCA-precipitated samples were resuspended in 1% SDS, vortexed, and incubated at 55°C for 5 minutes. Samples were then neutralized, boiled for 3 minutes, homogenized, and analyzed by electrophoresis in 10% Tris-tricine gels, followed by fluorography. Lyophilized HPLC fractions were resuspended in sample buffer, neutralized, boiled, and electrophoresed as we have reported (39).

Calculations of clearance rates. The analysis of curves of radioactivity disappearance from the brain was as reported (40, 43). The percentage of radioactivity remaining in the brain after microinjection was determined as

(Equation 1)1

where Nb is the radioactivity remaining in the brain at the end of the experiment, and Ni is the radioactivity injected into the brain.

In all calculations, the dpm values for [14C]inulin and the cpm values for TCA-precipitable 125I radioactivity were used. Inulin was studied as a metabolically inert polar reference marker that is neither transported across the BBB nor retained by the brain (40); its clearance rate, kinulin, provides a measure of the ISF bulk flow and is calculated as

(Equation 2)2

In the case of Aβ, there are two possible physiological pathways of elimination: direct transport across the BBB into the bloodstream, and elimination via ISF bulk flow into the CSF and cervical lymphatics. It is also possible that Aβ is retained within the brain by binding to its cell-surface receptors directly as a free peptide, and/or by binding to different transport proteins. Thus, according to the model, the fraction of Aβ remaining in the brain can be expressed as

(Equation 3)3

where a1 = k2/(k1 + k2) and a2 = k1/(k1 + k2), and k1 and k2 denote the fractional coefficients of total efflux from the brain and retention within the brain, respectively.

The fractional rate constant of Aβ efflux across the BBB from brain parenchyma can be calculated by knowing the fractional rate coefficient of total efflux of Aβ and inulin as

(Equation 4)4

i.e., as the difference between the fractional rate constant for total efflux of Aβ and the fractional rate constant of inulin. The half-saturation concentration for the elimination of Aβ via transport across the BBB, k1/2, was calculated from the equation

(Equation 5) 5

where Clmax represents the maximal efflux capacity for the saturable component of Aβ clearance across the BBB, corrected for peptide clearance by the ISF flow. Clmax is expressed as a percentage of the injected dose, [1 – (Nb / Ni)] × 100, cleared from brain by saturable BBB transport over 30 minutes.

The MLAB mathematical modeling system (Civilized Software Inc., Silver Spring, Maryland, USA) was used to fit the compartmental model to the disappearance curves or percent recovery data with inverse square weight.

Immunocytochemical analysis in mice. Expression of LRP-1 and α2M in mouse brain was studied by immunohistochemical analysis. Fresh-frozen, acetone-fixed brain sections of 2-month-old and 9-month-old wild-type and apoE KO mice were stained using anti-human LRP R777 Ab that crossreacts with mouse LRP-1 (4446) (1.5 mg/ml; 1:300 dilution), and anti-mouse α2M Ab (as described above, 1:250 dilution). R777 was affinity purified over a Sepharose–LRP-1 heavy-chain column, as described (44). The number of positive vessels was counted in ten random fields by two independent blinded observers, and was expressed as percentage per square millimeter of section. The extent and intensity of staining in cellular elements was quantitated using the ESECO Digimatic Universal Imaging System (Electronic Systems Engineering Co., West Chester, Pennsylvania,USA) and NIH imaging systems. Microvessels were carefully excluded from the quantitation by suitably varying the magnitudes of measurement. The relative intensity of cellular staining (excluding the microvasculature) in brain sections of young mice was arbitrarily normalized to 1 for purposes of comparison. Routine controls included sections prepared without primary Ab, without secondary Ab, and the use of an irrelevant primary Ab.

Neuropathological analysis in humans. Three AD patients and three neurologically normal, age-matched controls from the Alzheimer’s Disease Research Center of the University of Southern California were evaluated clinically and were followed to autopsy. Included were three males and three females, ranging in age from 69 to 99 years.

Tissue blocks (1 cm3) were obtained postmortem (range 4–7 hours; mean 5 hours.), fixed in 10% neutral buffered formalin (pH 7.3; Sigma Chemical Co.), and embedded in paraffin or snap-frozen in liquid nitrogen–chilled isopentane. Tissues were sampled from the superior and middle frontal gyrus (Brodmann’s area 10), and the cerebellar hemisphere.

Sections were stained with either hematoxylin and eosin or thioflavine S, in a modification of Bielschowsky’s silver impregnation method (Gallyas stain). Thioflavine S–stained sections were viewed through a Zeiss fluorescence microscope with a narrow-band, blue/violet filter at 400–455 nm. Examination was performed by two independent observers. Diagnosis of AD was according to a modified protocol from the Consortium to Establish a Registry for Alzheimer’s Disease (52).

For immunocytochemical analysis, we used cryostat sections (10 μm) of frontal cortex (Brodmann’s area 10) that were air dried. Immunocytochemistry was performed using the avidin-biotin peroxidase complex method (Vector Laboratories Inc., Burlingame, California, USA). Antibodies included Aβ1-40, rabbit anti-human, 1:1,000 (1 mg/ml; Chemicon International, Temecula, California, USA); Aβ1-42, rabbit anti-human, 1:1,000 (1 mg/ml); the mouse mAb to the heavy chain of human LRP-1 designated 8G1, which is specific for human LRP-1 and recognizes an epitope on the 515-kDa subunit (53), 1:300 (1.5 mg/ml); and CD105 (clone SMG), mouse anti-human, 1:100 (0.1 mg/ml; Serotec Ltd., Oxford, United Kingdom). For single staining with CD105 and LRP, after incubation with primary Ab, sections were washed three times in PBS (pH 7.4), and treated with biotinylated anti-mouse IgG for 30 minutes. After three washes in PBS, slides were incubated with avidin-biotin–horseradish peroxidase complex for 30 minutes and washed three times in PBS. Binding was detected with an SG peroxidase detection kit (blue/gray; Vector Laboratories Inc.). For double labeling, after incubation with Aβ overnight at 4°C, sections were washed three times with PBS and treated with biotinylated anti-rabbit IgG. They were then washed again, and positivity was detected with NovaRED (Vector Laboratories Inc.). After three washes in PBS, the second primary Ab (LRP or CD-105) was applied, and staining was performed as described for single labeling. Imaging was accomplished using an Axiophot II microscope (Carl Zeiss Inc., Thornwood, New York, USA) equipped with a SPOT digital camera (Diagnostic Instruments Inc., Sterling Heights, Michigan, USA).

Results

Figure 1a illustrates brain radioactivity-disappearance curves of [14C]inulin and 125I-Aβ1-40 (TCA-precipitable 125I radioactivity) studied at a concentration of 60 nM. Clearance of inulin, a reference extracellular fluid (ECF) marker that is neither transported across the BBB nor retained by the brain (40, 43), approximated a single exponential decay, as expected from previous studies. The clearance curve reflecting total efflux of 125I-Aβ1-40 from brain was bi-exponential, and was much lower than that for inulin, indicating significant biological transport of Aβ1-40 out of the brain. The two components of Aβ1-40 efflux, rapid elimination by vascular transport across the BBB into the blood and slow elimination via the ISF flow, were computed from Figure 1a with equations 3 and 4 and are illustrated in Figure 1b. Figure 1b indicates significantly higher clearance of Aβ via BBB transport than via ISF bulk flow.

Figure 1

(a) Time-disappearance curves of [14C]inulin (open circles) and 125I-Aβ1-40 (60 nM; TCA-precipitable 125I radioactivity, filled circles) from the CNS after simultaneous microinjections of tracers into the caudate nucleus in mice. Each point represents the mean ± SD of three to seven animals. (b) Two components of 125I-Aβ1-40 efflux, vascular transport across the BBB (filled triangles) and transport via ISF bulk flow (open triangles), were computed with equations 3 and 4 using data from a. (c) Relative contributions to Aβ1-40 efflux by its transport across the BBB (open bar), diffusion via ISF bulk flow (filled bar), and retention (gray bar) in the brain were studied at 60 nM concentrations and calculated from the fractional coefficients given in Table 1.

The half-time (t1/2) for brain efflux of Aβ1-40 and inulin calculated from Figure 1a and equations 2 and 3 were 25.5 ± 2.0 minutes and 239.0 ± 12.5 minutes, respectively, a 9.4-fold difference (Table 1). The half-time of efflux of Aβ1-40 across the BBB was 34.6 ± 3.6 minutes, 6.9-fold faster than by ISF bulk flow. In addition to efflux, there was also a slow, time-dependent retention of Aβ1-40 in brain parenchyma with a t1/2 of 164.5 minutes. As shown in Table 1, the rate k (min-1) of clearance of Aβ1-40 from the brain was 7.9-fold higher than that for inulin. The relative contributions of Aβ1-40 efflux at 60 nM, by transport across the BBB and by ISF bulk flow based on 5-hour measurements, were 73.8% and 10.7% respectively, whereas 15.6% of the dose remained sequestered within the CNS (Figure 1c).

Table 1

Clearance rates (k) for 125I-Aβ1-40 and [14C]inulin

After CNS injection, both tracers reached the CSF; the CSF time-appearance curves are shown in Figure 2a. The amount of 125I-Aβ1-40 (TCA-precipitable 125I radioactivity) measured in the CSF was lower than that for inulin at each studied timepoint, possibly reflecting active clearance of Aβ1-40 from the CSF, as was suggested previously (28). It is noteworthy that at each studied timepoint, the 125I-labeled material in the CSF was greater than 96% TCA-precipitable, indicating no degradation of the peptide. Both tracers also appeared in plasma (Figure 2b), and higher levels of TCA-precipitable 125I-Aβ1-40 radioactivity than of [14C]inulin radioactivity were consistent with active transport of Aβ1-40 out of the CNS across the BBB. The absolute amounts of both tracers in the CSF and plasma were low, however, due to relatively rapid clearance from the CSF in comparison to slow ISF bulk flow (29), and significant systemic body clearance (48), respectively.

Figure 2

Time-appearance curves of [14C]inulin (open circles) and 125I-Aβ1-40 (60 nM; TCA-precipitable 125I radioactivity, filled circles) in the CSF (a) and plasma (b) after simultaneous microinjections of tracers into the caudate nucleus in mice. Values are expressed as percentages of injected dose (%ID); each point is mean ± SD of three to seven animals.

Figure 3 (a and b) illustrates that 125I-Aβ1-40 was not significantly degraded in brain ISF before its transport across the BBB, as determined by TCA, HPLC, and SDS-PAGE analysis of 125I radioactivity in brains. The TCA analysis suggests that only 4.2–9.9% of 125I radioactivity in brains was not TCA-precipitable at different timepoints within 270 minutes of intracerebral microinjection of 125I-Aβ1-40 (Figure 3a). The HPLC analysis of brain radioactivity confirmed the TCA results by indicating that 93.7% of the peptide remains intact in brain ISF at 60 minutes (Figure 3b, right). It is noteworthy that 125I-Aβ1-40 was more than 97% intact at the time of injection, as determined both by the HPLC and TCA analyses. The results were corroborated by SDS-PAGE analysis of lyophilized aliquots of HPLC peaks of brain homogenates at different timepoints after 125I-Aβ1-40 injection, showing a single radioactive band at about 4 kDa (Figure 3b, left). The identity of the radioactive components on gels as Aβ1-40 peptide was confirmed by Western blot analysis using anti-Aβ Ab and enhanced chemiluminescence as a detection system (not shown). More than 96% of 125I radioactivity in the CSF was TCA-precipitable at studied timepoints between 15 minutes and 270 minutes (not shown). In contrast, degradation products of 125I-Aβ1-40 were found in plasma (Figure 3c); the amount of degraded 125I-Aβ1-40 corresponding to non–TCA-precipitable 125I radioactivity increased from 37.6% to 58.3% during the period from 15 minutes to 120 minutes after intracerebral microinjection of intact 125I-Aβ1-40 (Figure 3c). It is noteworthy that the amount of radioactivity in plasma after 120 minutes was relatively small, and approached the limits of sensitivity of the TCA assay.

Figure 3

(a) Brain TCA-precipitable (open bars) and non–TCA-precipitable 125I radioactivity (solid bars) after intracerebral microinjections of 125I-Aβ1-40 (60 nM) into the caudate nucleus in mice, expressed as a percentage of total 125I radioactivity in the brain; mean ± SD of three to five animals. (b) Left panel shows HPLC elution profile of brain tissue 60 minutes after intracerebral microinjection of 125I-Aβ1-40 (60 nM). Separation was performed for 30 mg of brain tissue on a reverse-phase HPLC column, using a 30-minute linear gradient of 25–83% acetonitrile in 0.1% TFA, pH 2. 125I-Aβ1-40 eluted at 52%, corresponding to the elution time of Aβ1-40 standard. Right panel shows SDS-PAGE analysis of brain tissue supernatant at 30 minutes (lane 1) and 60 minutes (lane 2) after intracerebral microinjection of 125I-Aβ1-40 (60 nM). The radioactivity in the brain eluted as a single peak on HPLC, with the same retention time as the Aβ1-40 standard (data not shown). Aliquots of lyophilized sample were subjected to 10% Tris-tricine SDS-PAGE, transferred to a nitrocellulose membrane, and exposed to x-ray film. (c) Plasma TCA-precipitable (open bars) and non–TCA-precipitable 125I radioactivity (filled bars) after intracerebral microinjections of 125I-Aβ1-40 (60 nM) into the caudate nucleus in mice, expressed as a percentage of total 125I radioactivity in plasma; mean ± SD of three to five animals.

Clearance of Aβ in young mice was concentration dependent (Figure 4a). The efflux transport system was half saturated (K1/2) at 15.3 nM of Aβ1-40. The plateau or maximal clearance capacity was reached between 70 nM and 100 nM, and further increases in Aβ concentration resulted in progressively greater retention of the peptide in the brain. In contrast, clearance of [14C]inulin did not change with increasing concentrations of Aβ, suggesting a physiologically intact BBB (Figure 4a).

Figure 4

(a) Concentration-dependent clearance of Aβ1-40 from mouse brain. Clearance via BBB transport (filled circles) is shown separately from clearance via ISF bulk flow (open circles). Clearance was determined 30 minutes after simultaneous microinjection of 125I-Aβ1-40 at increasing concentrations (0.05–120 nM) along with [14C]inulin into the caudate nucleus. (b) Effects of anti–LRP-1 Ab R777 (60 μg/ml), RAP (0.2 and 5 μM), anti-α2M Ab (20 μg/ml), and anti–LRP-2 Ab Rb6286 (60 μg/ml) on brain clearance of 125I-Aβ1-40 at 12 nM, determined 30 minutes after simultaneous microinjection of 125I-Aβ1-40 and [14C]inulin. (c) Effects of anti–LRP-1 Ab R777 (60 μg/ml), anti-RAGE Ab (60 μg/ml), fucoidin (100 μg/ml), and 2-amino-bicyclo[2.2.1]heptane-2-carboxylic acid (BCH; 10 mM) on brain clearance of 125I-Aβ1-40 at a higher load of 60 nM, determined 30 minutes after simultaneous microinjection of 125I-Aβ1-40 and [14C]inulin. Mean ± SD of three to four animals. AP < 0.05; NS, not significant.

The next set of experiments was designed to characterize the BBB transport system responsible for the transcytosis of Aβ. Brains were loaded with 125I-Aβ1-40 at either 12 nM (Figure 4b) or 60 nM (Figure 4c), and clearance was determined at 30 minutes in the absence and presence of several molecular reagents that may act as potential inhibitors of and/or competitors in export. Figure 4b indicates that both the LRP-1 Ab (60 μg/ml) and RAP (200 nM) produced significant (58% and 30%, respectively) reductions in Aβ clearance from the brain compared with vehicle-treated controls; increasing the concentration of RAP to 5 μM decreased Aβ clearance by 44%. A significant (25%) inhibition in Aβ clearance was also obtained in the presence of anti-α2M Ab (20 μg/ml). In contrast, anti–LRP-2 Ab (Figure 4b) and anti-RAGE Ab (Figure 4c) did not affect Aβ clearance. Fucoidin, a specific ligand for SR-A, produced a modest increase in clearance, possibly by blocking the binding of Aβ to parenchymal SR-A receptors, thereby allowing more peptide to be available for clearance. At higher Aβ loads (Figure 4c), anti–LRP-1 Ab produced a 53% decrease in clearance, similar to that observed at a lower load (Figure 4b), but Aβ recovery approached that of [14C]inulin, suggesting drainage of the peptide almost exclusively via ISF bulk flow. Clearance of [14C]inulin was not affected by any of the studied molecular reagents. We also demonstrated that BCH, a substrate that specifically blocks the L system for amino acids, does not affect clearance of Aβ across the BBB. This excludes the possibility that 125I-Aβ1-40 is degraded to 125I-tyrosine that is then transported out of the CNS instead of 125I-Aβ1-40.

Next, we studied the effect of apoE and aging by determining Aβ clearance in 2-month-old and 9-month-old apoE KO mice and wild-type mice, using two different loads of 125I-Aβ1-40, 12 nM (Figure 5a) and 60 nM (Figure 5b). Figure 5a shows that the clearance of Aβ was reduced by 30% in young apoE KO mice, and by about 55% and 40% in 9-month-old wild-type and apoE KO mice, respectively. These results were confirmed at a higher load of Aβ; the observed decrease in clearance was 46% in 9-month-old apoE KO mice (Figure 5b).

Figure 5

(a) Effect of apoE genotype and age on brain clearance of 125I-Aβ1-40. Brain clearance of 125I-Aβ1-40 in 2-month-old and 9-month-old wild-type mice and apoE KO mice studied at the lower load of 12 nM 125I-Aβ1-40 (a) and a higher load of 60 nM (b). In all studies, 125I-Aβ1-40 and [14C]inulin were injected simultaneously, and clearance was determined after 30 minutes. Mean ± SD of three to four animals. AP < 0.05; NS, not significant compared with 2-month-old wild-type mice.

Immunocytochemical studies confirmed abundant expression of LRP-1 in brain microvessels (including capillaries, small venules, and arterioles) in 2-month-old mice (Figure 6a, upper panel; and Figure 6b, upper panel), in addition to significant parenchymal cellular (including neuronal) staining (Figure 6a, upper panel). As shown in the lower panels of Figures 6a and 6b, there was a significant reduction in LRP-1–positive vessels in 9-month-old mice compared with 2-month-old mice; the number of LRP-1–positive vessels dropped from 94% in 2-month-old mice to 52% in 9-month-old mice (Figure 6d, upper panel). Quantitative analysis of LRP-1–positive parenchymal cells (excluding blood vessels) showed a trend toward reduced staining in older animals, though the difference was not statistically significant (Figure 6d, lower panel). Similarly, there was no difference between young and old mice in the number of α2M-positive microvessels or parenchymal cells in the brain (Figure 6c, upper and lower panels, respectively; Figure 6d, lower panel). It is noteworthy that staining for α2M was not able to distinguish between circulating α2M and α2M expressed on microvessels.

Figure 6

(a) LRP-1 immunoreactivity in brain microvessels of young (2-month-old; upper panel) and old (9-month-old; lower panel) wild-type mice. Many vessels in young mice stained positive for LRP-1, detected with anti–LRP-1 Ab R777 (5 μg/ml; arrows). There were relatively fewer positive vessels in old mice (arrows), and many weakly positive- or negative-staining vessels (arrowheads). There was no significant difference in the staining of parenchymal cellular elements (open arrows) between the young and old mice. Vessels in young mice stained strongly positive (b, upper panel) compared with the faint staining seen in old mice (b, lower panel). In contrast, there was no difference in staining for α2M in brain cells (arrowheads) or microvessels (arrows) between young (c, upper panel) and old (c, lower panel) mice. (d) Comparison of LRP-1 and α2M immunoreactivity in brain microvessels (upper panel) and parenchymal cellular elements (lower panel) in young and old wild-type mice. AP < 0.05; NS, not significant.

Frontal cortex of all AD patients revealed moderate to marked neuritic plaques and Aβ deposits; two of the three showed parenchymal and vascular amyloid. Controls revealed no neuritic plaques or Aβ in the parenchyma, and only meningeal vascular Aβ in one of the three patients. As seen in Figure 7a, staining for LRP-1 in the frontal cortex of control patients revealed moderate vascular staining in capillaries and arterioles, as well as neuronal staining. There was reduced LRP-1 staining in AD tissues, including regions with Aβ1-40-positive or Aβ1-42-positive plaques and vessels (Figure 7b). However, the immediate subcortical white matter showed more robust vascular staining for LRP-1, and absence of staining for Aβ, in both AD patients and controls (not shown). Anti-CD105, which identifies vascular endothelium, revealed ample staining of capillaries and arterioles of frontal cortex in controls, and moderately reduced numbers of stained vessels in AD tissues. Cerebellum revealed equivalent vascular staining with anti–LRP-1 and anti-CD105 in AD and control sections (not shown). No anti-Aβ1-40–positive or Aβ1-42–positive staining was seen in either AD or control tissues.

Figure 7

LRP-1 expression in human frontal cortex. Brain sections (Brodmann’s area 10) of controls (a and c) reveal well-defined staining of capillaries (arrowheads) and arterioles (arrows) by LRP-1, detected with anti–LRP-1 mAb 8G1 (5 μg/ml) (a) and CD105 (c). No Aβ staining was present in double-labeled or serially labeled sections (not shown). In contrast, double-labeled sections from AD patients show vessels and plaque cores stained positive with anti-Aβ1-40 (brown stain), reduced numbers and intensity of LRP-1 staining of vessels (b), and reduced numbers of CD105-labeled vessels (d).

Discussion

This study demonstrates the importance of vascular transport across the BBB in clearing Aβ from the brain into the circulation. Moreover, we provide evidence that this transport mechanism is mediated mainly via LRP-1 in brain microvascular endothelium, and suggest that transport of brain-derived Aβ out of the CNS may be influenced by the LRP-1 ligands α2M and apoE. This vascular clearance mechanism for Aβ is age dependent, and lower clearance rates in older animals correlate with decreased vascular abundance of LRP-1.

The capability of BBB to remove Aβ was significant in younger animals. The elimination time, t1/2, for Aβ1-40 at 60 nM was 25 minutes, or 9.4-fold faster than for inulin, an ECF marker used to determine the ISF bulk flow rate (40). The major component of the CNS efflux of Aβ was transport across the BBB into the vascular system. The clearance of Aβ across the BBB was dependent on both time and concentration. At very low concentrations, i.e., less than 2 nM as found normally in mouse brain (5455), Aβ1-40 was eliminated from brain at a rate that was on average 3.5-fold faster than when it was present at a load of 60 nM. This may be comparable to concentrations of Aβ1-40 found in the brains of transgenic APP animals at 3–4 months of age (5455). The efflux transport system was half saturated at 15.3 nM of Aβ1-40, and appears to be fully saturated at concentrations between 70 nM and 100 nM. Thus, this efflux transporter may be completely saturated by higher levels of Aβ, as are found in the brains of older transgenic APP animals (5455), which in turn may lead to vascular accumulation of Aβ and development of prominent deposits of cerebrovascular amyloid, as recently described (5657).

In this study, we did not observe significant metabolism or degradation of Aβ1-40 within 5 hours, in contrast to a recent report suggesting that Aβ1-42 is degraded by enkephalinase (neprilysin) in the brain within minutes (28). It may be that Aβ1-40 and Aβ1-42 are processed differently in the brain. However, the physiological relevance of the proposed degradation mechanism for Aβ1-42 (28) remains unclear, because the peptide was studied at extremely high concentrations (∼240 μM) that are not found even in brains with severe β-amyloidosis (30). As shown by pharmacological studies, these high concentrations of Aβ may impair local BBB integrity (5859), which in turn may contaminate brain ISF with blood and/or plasma that possesses Aβ-degrading activity (48), as confirmed in this study.

Consistent with the hypothesis that cytosolic peptidases have little access to Aβ peptides secreted or injected into brain ISF (28) or CSF (29), it has been reported recently that insulin-degrading enzyme (IDE) cannot not degrade Aβ in the brain in vivo after intracerebral injection of radiolabeled peptide (28). This is in contrast to in vitro degradation of 125I-Aβ1-40 by IDE from brain and liver cytosol fractions (60). Because IDE is an intracellular protease, it is not surprising that IDE may not be able to process Aβ from brain ISF, particularly if peptide clearance is faster than its cellular uptake, as suggested by our data and a previous study (28). It is noteworthy that brain endothelial cells in vitro (33) and astrocytes (61) do not catabolize Aβ, in contrast to activated microglial cells that secrete a specific metalloproteinase that degrades Aβ in vitro (61). Neuronal cells in vitro metabolize Aβ via an LRP-1–dependent mechanism that may require apoE or α2M (38). The rate of this degradation, however, is about 50- to 100-fold slower than that occurring via transport across the BBB in vivo.

Transport of Aβ out of the CSF was not associated with significant degradation of peptide in the CSF (29). Lower levels of Aβ1-40 than inulin in the CSF may suggest active transport of Aβ from the CSF to the blood, possibly across the choroid plexus or leptomeningeal vessels, as shown previously (29). Higher levels of radiolabeled Aβ in the plasma relative to inulin confirm vascular transport of the peptide out of the CNS. Although our results indicate that brain-derived Aβ could contribute to the pool of circulating peptide, its degradation in plasma, systemic metabolism, and body clearance tend to reduce the levels of circulating peptide, as shown previously (48). Under our experimental conditions, the levels of radiolabeled Aβ in the circulation were two to three orders of magnitude lower than the brain levels. This makes re-entry of radiolabeled Aβ into the brain very unlikely, because the blood-to-brain transport of Aβ normally operates down the concentration gradient (39, 6265). In addition, the apoJ system that transports blood-borne Aβ into the brain is saturated under the physiological conditions (64) that may facilitate the efflux of Aβ from the brain. Previous studies have shown that circulating free Aβ is also metabolized during its transport across the BBB (48, 49, 65, 66), possibly by pericytes, which represent a major enzymatic barrier for the transport of several peptides and proteins across the BBB (67).

The affinity of neprilysin for its physiological substrates (e.g., enkephalins, tachykinins, atrial natriuretic peptide) and/or different synthetic peptides is in the low millimolar range (68). In contrast, the levels of Aβ in the brain are normally in the low nanomolar range, and in transgenic mouse models of brain amyloidosis they vary from 40 nM to 250 nM/kg from 3 to 12 months of age (54). Thus, under physiological and/or pathological conditions, Aβ will likely bind to its high-affinity cell-surface receptors (such as RAGE and/or SR-A), and/or high-affinity transport binding proteins (α2M, apoE, and apoJ), which all react with low nanomolar levels of peptide corresponding to their KD values.

In this study, anti–LRP-1 antibodies inhibited Aβ1-40 clearance by about 55%, both at lower (12 nM) and higher loads (60 nM) of the peptide, suggesting the involvement of LRP-1 in vascular elimination of Aβ from the brain. RAP, a chaperone protein that facilitates proper folding and subsequent trafficking of LRP-1 and LRP-2 (69), also inhibited Aβ clearance. RAP binds to multiple sites on LRP and antagonizes binding of all known LRP ligands to both LRP-1 and LRP-2 in vitro (69), as well as to LRP-2 in vivo at the blood side of the BBB (39). In this study, RAP at higher concentrations produced inhibition of Aβ clearance comparable to that produced by an anti–LRP-1 Ab. It is interesting that anti–LRP-1 Ab inhibited vascular transport of Aβ almost completely at higher concentrations of peptide, which may indicate that LRP-1 could be of primary importance in eliminating the peptide from the brain. At a lower load of the peptide (i.e., 12 nM), neither of the molecular reagents was able to abolish clearance of Aβ, which suggests that in addition to LRP-1, there may be an alternative, highly sensitive BBB transport mechanism (or mechanisms) that eliminates the peptide from the brain at very low concentrations. The molecular nature of this putative second transport system is not presently known, although data from this study suggest that RAGE and LRP-2 are unlikely to be involved in rapid elimination of Aβ from brain. The fact that fucoidin, an SR-A ligand, moderately increased clearance of Aβ suggests that inhibition of SR-A receptors in the brain may decrease CNS sequestration of the peptide, thus allowing more peptide to be available for enhanced clearance across the BBB.

A role for LRP-1 in promoting Aβ clearance in vitro in smooth muscle cells, neurons, and fibroblasts via α2M and apoE has been suggested (3538), although at significantly slower rates than the Aβ transport across the BBB demonstrated in this study. High-affinity in vitro binding of Aβ to α2M and to lipidated apoE3 and apoE4, and a lower-affinity binding to delipidated apoE isoforms has been well documented (23, 70). Binding/uptake studies in mouse embryonic fibroblasts (wild type and deficient in LRP-1), confirmed that free Aβ is not a ligand for LRP-1 (37, 45). The possible role of the two LRP-1 ligands in elimination of Aβ via vascular transport is suggested by inhibition of Aβ clearance with anti-α2M antibodies and by significantly reduced clearance in apoE KO animals (by 30% and 46% at 2 months and 9 months of age, respectively, compared with young wild-type controls). In relation to these findings, it is interesting to note that recent studies have indicated that lack of endogenous mouse apoE in both the APPV717F and APPsw mouse models of AD results in less Aβ deposition and no fibrillar Aβ deposits in the brain (57, 71). This suggests that mouse apoE strongly facilitates Aβ fibrillogenesis. It is possible that mouse apoE also plays a role in clearance of soluble Aβ across the BBB, as suggested by the current study, but that its ability to influence Aβ aggregation in APP transgenic mice is dominant. In contrast to the effects of mouse apoE, a recent study demonstrates that human apoE isoforms suppress early Aβ deposition in APPV717F mice (72). Further studies in this model will be useful to determine whether this suppressive effect of human apoE isoforms on early Aβ deposition is secondary to effects on facilitating Aβ transport across the BBB. Although our study does not rule out the possibility that Aβ clearance by neurons, vascular smooth muscle cells, and fibroblasts shown in vitro (3538) may also occur in vivo, vascular transport across the BBB seems to be of primary importance for rapid elimination of Aβ from brain in vivo.

Because normal aging is associated with Aβ accumulation in the brain (1), and there is a significant, time-dependent, and progressive accumulation of the peptide with age in transgenic APP animals (54, 55), we postulated that Aβ clearance mechanisms might be impaired in older animals, and are also possibly impaired in elderly humans. Our findings of about 55–65% inhibition of Aβ clearance in 9-month-old wild-type animals compared with young (2-month-old) animals confirmed this hypothesis. Immunocytochemical studies indicated a significant reduction in the number of LRP-1–positive cerebral blood vessels, from 94% in 2-month-old mice to 52% in 9-month-old mice, which correlated well with the observed reductions in the clearance capacities in the two age groups. Interestingly, downregulation of vascular LRP-1 correlated well with regional parenchymal and vascular accumulation of Aβ in brains of Alzheimer’s patients compared with age-matched controls. In brain areas where LRP-1 vascular expression remains prominent, such as in the white matter, no accumulation of Aβ was found in Alzheimer’s brains.

In conclusion, our data support the concept that the vascular system plays an important role in regulating the levels of Aβ in the brain. Our findings further suggest that if the levels of Aβ in brain extracellular space exceed the transport capacity of the clearance mechanism across the BBB, or if the vascular transport of the peptide were impaired, for example by downregulation of LRP-1, this would result in accumulation of Aβ in the brain, and possibly formation of amyloid plaques. Previous studies from our laboratory and others have demonstrated a major role of the BBB in determining the concentrations of Aβ in the CNS by regulating transport of circulating Aβ (33, 39, 4951, 6266). This study extends this hypothesis by showing that vascular transport out of the brain across the BBB may represent a major physiological mechanism that prevents accumulation of Aβ and amyloid deposition in the brain.

Acknowledgments

This work was supported in part by NIH grants AG-16223 and NS-33466 (to B.V. Zlokovic), AG-05891 (to B. Frangione), AG-05142 (to C. Finch and C.A. Miller), AG-13956 (to D.M. Holtzman), NS-38777 (to J. Ghiso), and HL-50784 (to D.K. Strickland). We acknowledge the excellent technical assistance of Celia Williams.

References

  1. Wisniewski, T, Ghiso, J, Frangione, B. Biology of Aβ amyloid in Alzheimer’s disease. Neurobiol Dis 1997. 4:311-328.
    View this article via: CrossRef
  2. Selkoe, DJ. Alzheimer’s disease: genotype, phenotype, and treatments. Science 1997. 275:630-631.
    View this article via: PubMed CrossRef
  3. Selkoe, DJ. The cell biology of β-amyloid precursor protein and presenilin in Alzheimer’s disease. Trends Cell Biol 1998. 8:447-453.
    View this article via: PubMed CrossRef
  4. Younkin, SG. The role of Aβ42 in Alzheimer’s disease. J Physiol (Paris) 1998. 92:289-292.
    View this article via: PubMed CrossRef
  5. Roses, AD. Alzheimer disease: a model of gene mutations and susceptibility polymorphisms for complex psychiatric diseases. Am J Med Genet 1998. 81:49-57.
    View this article via: PubMed CrossRef
  6. Hardy, J, Duff, K, Hardy, KG, Perez-Tur, J, Hutton, M. Genetic dissection of Alzheimer’s disease and related dementias: amyloid and its relationship to tau. Nat Neurosci 1998. 1:355-358.
    View this article via: PubMed CrossRef
  7. Masters, CL, et al. Amyloid plaque core protein in Alzheimer disease and Down syndrome. Proc Natl Acad Sci USA 1985. 82:4245-4249.
    View this article via: PubMed CrossRef
  8. Prelli, F, Castano, EM, Glenner, GG, Frangione, B. Differences between vascular and plaque core amyloid in Alzheimer’s disease. J Neurochem 1988. 51:648-651.
    View this article via: PubMed CrossRef
  9. Roher, AE, et al. β-amyloid (1–42) is a major component of cerebrovascular amyloid deposits: implications for the pathology of Alzheimer disease. Proc Natl Acad Sci USA 1993. 90:10836-10840.
    View this article via: PubMed CrossRef
  10. Shinkai, Y, et al. Amyloid β-proteins 1-40 and 1-42(43) in the soluble fraction of extra- and intracranial blood vessels. Ann Neurol 1995. 38:421-428.
    View this article via: PubMed CrossRef
  11. Castaño, EM, et al. The length of amyloid-β in hereditary cerebral hemorrhage with amyloidosis, Dutch type. Implications for the role of amyloid-β 1-42 in Alzheimer’s disease. J Biol Chem 1996. 271:32185-32191.
    View this article via: PubMed CrossRef
  12. Seubert, P, et al. Isolation and quantification of soluble Alzheimer’s amyloid-β peptide from biological fluids. Nature 1992. 359:325-327.
    View this article via: PubMed CrossRef
  13. Shoji, M, et al. Production of the Alzheimer amyloid-β protein by normal proteolytic processing. Science 1996. 258:126-129.
    View this article via: PubMed CrossRef
  14. Vigo-Pelfrey, C, Lee, D, Keim, P, Lieberburg, I, Schenk, DB. Characterization of β-amyloid peptide from human cerebrospinal fluid. J Neurochem 1993. 61:965-968.
  15. Tabaton, M, et al. Soluble amyloid β-protein is a marker of Alzheimer amyloid in brain but not in cerebrospinal fluid. Biochem Biophys Res Commun 1994. 200:1598-1603.
    View this article via: PubMed CrossRef
  16. Kuo, YM, et al. Water-soluble Aβ (N-40, N-42) oligomers in normal and Alzheimer disease brains. J Biol Chem 1996. 271:4077-4081.
    View this article via: PubMed CrossRef
  17. Ghiso, J, et al. The cerebrospinal-fluid soluble form of Alzheimer’s amyloid-β is complexed to SP-40, 40 (apolipoprotein J), and inhibitor of the complement membrane-attack complex. Biochem J 1993. 293:27-30.
    View this article via: PubMed
  18. Matsubara, E, Frangione, B, Ghiso, J. Characterization of apolipoprotein J-Alzheimer’s Aβ interaction. J Biol Chem 1995. 270:7563-7567.
    View this article via: PubMed CrossRef
  19. Yang, DS, Smith, JD, Zhou, Z, Gandy, SE, Martins, RN. Characterization of the binding of amyloid-β peptide to cell culture-derived native apolipoprotein E2, E3, and E4 isoforms and to isoforms from human plasma. J Neurochem 1997. 68:721-725.
    View this article via: PubMed
  20. Schwarzman, AL, et al. Transthyretin sequesters amyloid β-protein and prevents amyloid formation. Proc Natl Acad Sci USA 1994. 91:8368-8372.
    View this article via: PubMed CrossRef
  21. Matsubara, E, et al. Lipoprotein-free amyloidogenic peptides in plasma are elevated in patients with sporadic Alzheimer’s disease and Down’s syndrome. Ann Neurol 1999. 45:537-541.
    View this article via: PubMed CrossRef
  22. Biere, AL, et al. Amyloid β-peptide is transported on lipoproteins and albumin in human plasma. J Biol Chem 1996. 271:32916-32922.
    View this article via: PubMed CrossRef
  23. Du, Y, et al. β2-Macroglobulin as a β-amyloid peptide-binding plasma protein. J Neurochem 1997. 69:299-305.
    View this article via: PubMed
  24. Busciglio, J, Gabuzda, DH, Matsudaira, P, Yanker, BA. Generation of β-amyloid in the secretory pathway in neuronal and non-neuronal cells. Proc Natl Acad Sci USA 1993. 90:2092-2096.
    View this article via: PubMed CrossRef
  25. Naslund, J, et al. Relative abundance of Alzheimer Aβ amyloid peptide variants in Alzheimer disease and normal aging. Proc Natl Acad Sci USA 1994. 91:8378-8382.
    View this article via: PubMed CrossRef
  26. Teller, JK, et al. Presence of soluble amyloid β-peptide precedes amyloid plaque formation in Down’s syndrome. Nat Med 1996. 2:93-95.
    View this article via: PubMed CrossRef
  27. Suzuki, N, et al. High tissue content of soluble amyloid-β 1-40 is linked to cerebral amyloid angiopathy. Am J Pathol 1994. 145:452-460.
    View this article via: PubMed
  28. Iwata, N, et al. Identification of the major Aβ1-42-degrading catabolic pathway in brain parenchyma: suppression leads to biochemical and pathological deposition. Nat Med 2000. 6:143-150.
    View this article via: PubMed CrossRef
  29. Ghersi-Egea, JF, et al. Fate of cerebrospinal fluid-borne amyloid β-peptide: rapid clearance into blood and appreciable accumulation by cerebral arteries. J Neurochem 1996. 67:880-883.
    View this article via: PubMed
  30. Zlokovic, BV, Yamada, S, Holtzman, D, Ghiso, J, Frangione, B. Clearance of amyloid β-peptide from brain: transport or metabolism? Nat Med 2000. 6:718-719.
    View this article via: PubMed
  31. Rosenberg, RN. The molecular and genetic basis of AD: the end of the beginning. Neurology 2000. 54:2045-2054.
    View this article via: PubMed
  32. Yan, SD, et al. RAGE and amyloid-β peptide neurotoxicity in Alzheimer’s disease. Nature 1996. 382:685-691.
    View this article via: PubMed CrossRef
  33. Mackic, JB, et al. Human blood-brain barrier receptors for Alzheimer’s amyloid-β1-40: asymmetrical binding, endocytosis and transcytosis at the apical side of brain microvascular endothelial cell monolayer. J Clin Invest 1998. 102:734-743.
    View this article via: JCI.org PubMed CrossRef
  34. Paresce, DM, Ghosh, RN, Maxfield, FR. Microglial cells internalize aggregates of the Alzheimer’s disease amyloid β-protein via a scavenger receptor. Neuron 1996. 17:553-565.
    View this article via: PubMed CrossRef
  35. Urmoneit, B, et al. Cerebrovascular smooth muscle cells internalize Alzheimer amyloid β-protein via a lipoprotein pathway: implications for cerebral amyloid angiopathy. Lab Invest 1997. 77:157-166.
    View this article via: PubMed
  36. Jordan, J, et al. Isoform-specific effect of apolipoprotein E on cell survival and β-amyloid-induced toxicity in rat hippocampal pyramidal neuronal cultures. J Neurosci 1998. 18:195-204.
    View this article via: PubMed
  37. Narita, M, Holtzman, DM, Schwartz, AL, Bu, G. α2-macroglobulin complexes with and mediates the endocytosis of β-amyloid peptide via cell surface low-density lipoprotein receptor-related protein. J Neurochem 1997. 69:1904-1911.
    View this article via: PubMed
  38. Qiu, Z, Strickland, DK, Hyman, BT, Rebeck, GW. α2-macroglobulin enhances the clearance of endogenous soluble β-amyloid peptide via low-density lipoprotein receptor-related protein in cortical neurons. J Neurochem 1999. 73:1393-1398.
    View this article via: PubMed CrossRef
  39. Zlokovic, BV, et al. Glycoprotein 330/megalin: probable role in receptor-mediated transport of apolipoprotein J alone and in a complex with Alzheimer’s disease amyloid β at the blood-brain and blood-cerebrospinal fluid barriers. Proc Natl Acad Sci USA 1996. 93:4229-4236.
    View this article via: PubMed CrossRef
  40. Yamada, S, dePasquale, M, Patlak, CS, Cserr, HF. Albumin outflow into deep cervical lymph from different regions of rabbit brain. Am J Physiol 1991. 261:H1197-H1204.
    View this article via: PubMed
  41. Strittmater, W, Roses, A. Apolipoprotein E and Alzheimer’s disease. Annu Rev Neurosci 1996. 19:53-77.
    View this article via: PubMed CrossRef
  42. Blacker, D, et al. α2-macroglobulin is genetically associated with Alzheimer’s disease. Nat Genet 1998. 19:357-360.
    View this article via: PubMed CrossRef
  43. Zlokovic, BV, Davson, H, Preston, JE, Segal, MB. Effects of aluminum on cerebrospinal fluid secretion. Exp Neurol 1987. 98:436-452.
    View this article via: PubMed CrossRef
  44. Kounnas, MZ, et al. The α2-macroglobulin receptor/low density lipoprotein receptor-related protein binds and internalizes Pseudomonas exotoxin A. J Biol Chem 1992. 267:12420-12423.
    View this article via: PubMed
  45. Kounnas, MZ, et al. LDL receptor-related protein, a multifunctional ApoE receptor, binds secreted β-amyloid precursor protein an mediates its degradation. Cell 1995. 82:331-340.
    View this article via: PubMed CrossRef
  46. Mikhailenko, I, Kounnas, MZ, Strickland, DK. Low density lipoprotein receptor-related protein/α 2-macroglobulin receptor mediates the cellular internalization and degradation of thrombospondin. A process facilitated by cell-surface proteoglycans. J Biol Chem 1995. 270:9543-9549.
    View this article via: PubMed CrossRef
  47. Kounnas, MZ, Haudenschild, CC, Strickland, DK, Argraves, WS. Immunological localization of glycoprotein 330, low density lipoprotein receptor related protein and 39 kDa receptor associated protein in embryonic mouse tissues. In Vivo 1994. 8:343-351.
    View this article via: PubMed
  48. Mackic, JB, et al. Cerebrovascular accumulation and increased blood-brain barrier permeability to circulating Alzheimer’s amyloid β-peptide in aged squirrel monkey with cerebral amyloid angiopathy. J Neurochem 1998. 70:210-215.
    View this article via: PubMed
  49. Maness, LM, Banks, WA, Podlisny, MB, Selkoe, DJ, Kastin, AJ. Passage of human amyloid-β protein 1-40 across the murine blood-brain barrier. Life Sci 1994. 55:1643-1650.
    View this article via: PubMed CrossRef
  50. Poduslo, JF, Curran, GL, Haggard, JJ, Biere, AL, Selkoe, DJ. Permeability and residual plasma volume of human, Dutch variant, and rat amyloid β-protein 1-40 at the blood-brain barrier. Neurobiol Dis 1997. 4:27-34.
    View this article via: PubMed CrossRef
  51. Martel, CL, et al. Isoform-specific effects of apolipoproteins E2, E3, E4 on cerebral capillary sequestration and blood brain barrier transport of circulating Alzheimer’s amyloid β. J Neurochem 1997. 69:1995-2004.
    View this article via: PubMed
  52. Hyman, BT, Trojanowski, JQ. Consensus recommendations for the postmortem diagnosis of Alzheimer disease from the National Institute on Aging and the Reagan Institute Working Group on diagnostic criteria for the neuropathological assessment of Alzheimer disease. J Neuropathol Exp Neurol 1997. 56:1095-1097.
    View this article via: PubMed CrossRef
  53. Strickland, DK, et al. Sequence identity between the α2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor. J Biol Chem 1990. 265:17401-17404.
    View this article via: PubMed
  54. Hsiao, K, et al. Correlative memory deficits, Aβ elevation, and amyloid plaques in transgenic mice. Science 1996. 274:99-102.
    View this article via: PubMed CrossRef
  55. Holcomb, L, et al. Accelerated Alzheimer-type phenotype in transgenic mice carrying both mutant amyloid precursor protein and presenilin 1 transgenes. Nat Med 1998. 4:97-100.
    View this article via: PubMed CrossRef
  56. Calhoun, ME, et al. Neuronal overexpression of mutant amyloid precursor protein results in prominent deposition of cerebrovascular amyloid. Proc Natl Acad Sci USA 1999. 96:14088-14093.
    View this article via: PubMed CrossRef
  57. Holtzman, DM, et al. ApoE facilitates neuritic and cerebrovascular plaque formation in the APPsw mouse model of Alzheimer’s disease. Ann Neurol 2000. 47:739-747.
    View this article via: PubMed CrossRef
  58. Blanc, EM, Toborek, M, Mark, RJ, Hennig, B, Mattson, MP. Amyloid β-peptide induces cell monolayer albumin permeability, impairs glucose transport, and induces apoptosis in vascular endothelial cells. J Neurochem 1997. 68:1870-1881.
    View this article via: PubMed
  59. Thomas, T, Thomas, G, McLendon, C, Sutton, T, Mullan, M. β-amyloid mediated vasoactivity and vascular endothelial damage. Nature 1996. 380:168-171.
    View this article via: PubMed CrossRef
  60. Kurochkin, IV, Goto, S. Alzheimer’s β-amyloid peptide specifically interacts with and is degraded by insulin degrading enzyme. FEBS Lett 1994. 345:33-37.
    View this article via: PubMed CrossRef
  61. Mentlein, R, Ludwig, R, Martensen, I. Proteolytic degradation of Alzheimer’s disease amyloid β-peptide by a metalloproteinase from microglia cells. J Neurochem 1998. 70:721-726.
    View this article via: PubMed
  62. Zlokovic, BV, et al. Blood-brain barrier transport of circulating Alzheimer’s amyloid-β. Biochem Biophys Res Commun 1993. 197:1034-1040.
    View this article via: PubMed CrossRef
  63. Ghilardi, JR, et al. Intra-arterial infusion of [125I]Aβ1-40 labels amyloid deposits in the aged primate brain in vivo. Neuroreport 1996. 7:2607-2611.
    View this article via: PubMed
  64. Shayo, M, McLay, RN, Kastin, AJ, Banks, WA. The putative blood-brain barrier transporter for the β-amyloid binding protein apolipoprotein J is saturated at physiological concentrations. Life Sci 1997. 60:L115-L118.
  65. Martel, CL, Mackic, JB, McComb, JG, Ghiso, J, Zlokovic, BV. Blood-brain barrier uptake of the 40 and 42 amino acid sequences of circulating Alzheimer’s amyloid-β in guinea pigs. Neurosci Lett 1996. 206:157-160.
    View this article via: PubMed CrossRef
  66. Saito, Y, Buciak, J, Yang, J, Pardridge, WM. Vector-mediated delivery of 125I-labeled β-amyloid peptide Aβ 1-40 through the blood-brain barrier and binding to Alzheimer’s disease amyloid to the Aβ1-40/ vector complex. Proc Natl Acad Sci USA 1995. 92:10227-10231.
    View this article via: PubMed CrossRef
  67. Krause, D, Kunz, J, Dermietzel, R. Cerebral pericytes: a second line of defense in controlling blood-brain barrier peptide metabolism. Adv Exp Med Biol 1993. 331:149-152.
    View this article via: PubMed
  68. Hersh, LB, Morihara, K. Comparison of subsite specificity of the mammalian neutral endopeptidase 24.11 (enkephalinase) to the bacterial neutral endopeptidase thermolysin. J Biol Chem 1986. 261:6433-6437.
    View this article via: PubMed
  69. Bu, G, Rennke, S. Receptor-associated protein is a folding chaperone for low-density lipoprotein receptor-related protein. J Biol Chem 1996. 271:22218-22224.
    View this article via: PubMed CrossRef
  70. Tokuda, T, et al. Lipidation of apolipoprotein E influences its isoform-specific interaction with Alzheimer’s amyloid β-peptides. Biochem J 2000. 348:359-365.
    View this article via: PubMed CrossRef
  71. Bales, KR, et al. Apolipoprotein E is essential for amyloid deposition in the APP(V717F) transgenic mouse model of Alzheimer’s disease. Proc Natl Acad Sci USA 1999. 96:15233-15238.
    View this article via: PubMed CrossRef
  72. Holtzman, DM, et al. In vivo expression of apolipoprotein E reduces amyloid β deposition in a mouse model of Alzheimer’s disease. J Clin Invest 1999. 103:R15-R21.
    View this article via: JCI.org PubMed CrossRef

Articles that cite
this article:

The Comorbidity of HIV-Associated Neurocognitive Disorders and Alzheimer’s Disease: A Foreseeable Medical Challenge in Post-HAART Era
Jiqing Xu, Tsuneya Ikezu
Jrnl NeuroImmune Pharm 4(2):200. [CrossRef]

Why lipids are important for Alzheimer disease?
Veronica Hirsch-reinshagen, Braydon L. Burgess, Cheryl L. Wellington
MOL CELL BIOCHEM 326(1-2):121. [CrossRef]

Genetics and molecular pathogenesis of sporadic and hereditary cerebral amyloid angiopathies
Tamas Revesz, Janice L. Holton, Tammaryn Lashley, Gordon Plant, Blas Frangione, Agueda Rostagno, Jorge Ghiso
Acta Neuropathol 118(1):115. [CrossRef]

Extracellular chaperones modulate the effects of Alzheimer’s patient cerebrospinal fluid on Aβ1-42 toxicity and uptake
Justin J. Yerbury, Mark R. Wilson
Cell Stress Chaperones [CrossRef]

Relative paucity of tau accumulation in the small areas with abundant Aβ42-positive capillary amyloid angiopathy within a given cortical region in the brain of patients with Alzheimer pathology
Kenichi Oshima, Haruhiko Akiyama, Kuniaki Tsuchiya, Hiromi Kondo, Chie Haga, Yoko Shimomura, Eizo Iseki, Hirotake Uchikado, Masanori Kato, Kazuhiro Niizato
Acta Neuropathol 111(6):510. [CrossRef]

Can statins put the brakes on Alzheimer’s disease?
James F Whitfield
Expert Opin Invest Drugs 15(12):1479. [CrossRef]

Neurovascular mechanisms and blood–brain barrier disorder in Alzheimer’s disease
Robert D. Bell, Berislav V. Zlokovic
Acta Neuropathol 118(1):103. [CrossRef]

Lipid Metabolism, Epidemiology, and the Mechanisms of Alzheimer's Disease
ROBERT P. Friedland
Ann N Y Acad Sci 977(1):387. [CrossRef]

Potential roles of abundant extracellular chaperones in the control of amyloid formation and toxicity
Mark R. Wilson, Justin J. Yerbury, Stephen Poon
Mol Biosyst 4(1):42. [CrossRef]

A shed form of LDL receptor–related protein–1 regulates peripheral nerve injury and neuropathic pain in rodents
Alban Gaultier, Sanja Arandjelovic, Xiaoqing Li, Julie Janes, Nikola Dragojlovic, George P. Zhou, Jenny Dolkas, Robert R. Myers, Steven L. Gonias, W. Marie Campana
J Clin Invest 118(1):161. [CrossRef]

Delineating the Mechanism of Alzheimer’s Disease Aβ Peptide Neurotoxicity
Roberto Cappai, Kevin J. Barnham
Neurochem Res 33(3):526. [CrossRef]

Alzheimer’s disease and the blood–brain barrier: past, present and future
Gene L Bowman, Joseph F Quinn
4(1):47. [CrossRef]

New pathways in drug discovery for alzheimer’s disease
Eric R. Siemers, Robert A. Dean, Ronald Demattos, Patrick C. May
Curr Neurol Neurosci Rep 6(5):372. [CrossRef]

The integrity of the blood?brain barrier in Alzheimer?s disease
A. Algotsson, B. Winblad
Acta Neurol Scand 115(6):403. [CrossRef]

Cerebral clearance of human amyloid-β peptide (1–40) across the blood–brain barrier is reduced by self-aggregation and formation of low-density lipoprotein receptor-related protein-1 ligand complexes
Shingo Ito, Sumio Ohtsuki, Junichi Kamiie, Yasuko Nezu, Tetsuya Terasaki
J Neurochem 103(6):2482. [CrossRef]

MDR1-P-Glycoprotein (ABCB1) Mediates Transport of Alzheimer’s Amyloid-β Peptides—Implications for the Mechanisms of Aβ Clearance at the Blood–Brain Barrier
Diana Kuhnke, Gabriele Jedlitschky, Markus Grube, Markus Krohn, Mathias Jucker, Igor Mosyagin, Ingolf Cascorbi, Lary C. Walker, Heyo K. Kroemer, Rolf W. Warzok
Brain Pathol 17(4):347. [CrossRef]

Apolipoprotein E, Amyloid-??, and Blood-Brain Barrier Permeability in Alzheimer Disease
John E. Donahue, Conrad E. Johanson
Neuropathol Exp Neurol 67(4):261. [CrossRef]

Phagocytic functions of microglial cells in the central nervous system and their importance in two neurodegenerative diseases: multiple sclerosis and Alzheimer’s disease
Nada Choucair, Vincent Laporte, Rachel Levy, Anne-Sophie Arnold, Jean-Pierre Gies, Philippe Poindron, Yves Lombard
cent eur j biol 1(4):463. [CrossRef]

Specific reactivity of mild/severe Alzheimer’s disease patient’s sera to antibody against Aβ1–40 epitope 17–21
F. F. Bolukbasi hatip, Y. Matsunaga, T. Yamada
Acta Neurol Scand 117(6):404. [CrossRef]

Apolipoproteins and ? Amyloid Transport Pathway
Kouzin Kamino, Tomoyuki Kida, Toshihisa Tanaka, Hisashi Tanii, Masayasu Okochi, Takashi Kudo, Toshiko Kobayashi, Masatoshi Takeda
2(3):149. [CrossRef]

Deposition of Alzheimer's ??-amyloid is inversely correlated with P-glycoprotein expression in the brains of elderly non-demented humans
Silke Vogelgesang, Ingolf Cascorbi, Eike Schroeder, Jens Pahnke, Heyo K. Kroemer, Werner Siegmund, Christiane Kunert-keil, Lary C. Walker, Rolf W. Warzok
12(7):535. [CrossRef]

Classification and basic pathology of Alzheimer disease
Charles Duyckaerts, Benoît Delatour, Marie-Claude Potier
Acta Neuropathol 118(1):5. [CrossRef]

Sporadic cerebral amyloid angiopathy: pathology, clinical implications, and possible pathomechanisms
Johannes Attems
Acta Neuropathol 110(4):345. [CrossRef]

LRP: a multifunctional scavenger and signaling receptor
Joachim Herz, Dudley K. Strickland
J Clin Invest 108(6):779. [CrossRef]

Perivascular Drainage of Amyloid-β Peptides from the Brain and Its Failure in Cerebral Amyloid Angiopathy and Alzheimer's Disease
Roy O. Weller, Malavika Subash, Stephen D. Preston, Ingrid Mazanti, Roxana O. Carare
Brain Pathol 18(2):253. [CrossRef]

The Role of the Immune System in Clearance of Aβ from the Brain
Delphine Boche, James A.R. Nicoll
Brain Pathol 18(2):267. [CrossRef]

Aβ-Degrading Enzymes in Alzheimer's Disease
James Scott Miners, Shabnam Baig, Jennifer Palmer, Laura E. Palmer, Patrick G. Kehoe, Seth Love
Brain Pathol 18(2):240. [CrossRef]

Environmental Enrichment Counteracts Alzheimer’s Neurovascular Dysfunction in TgCRND8 Mice
Arne Herring, Hamzah Yasin, Oliver Ambrée, Norbert Sachser, Werner Paulus, Kathy Keyvani
Brain Pathol 18(1):32. [CrossRef]

Cerebral amyloid angiopathy in a 95+ cohort: complement activation and apolipoprotein E (ApoE) genotype
M. Tanskanen, P. J. Lindsberg, P. J. Tienari, T. Polvikoski, R. Sulkava, A. Verkkoniemi, S. Rastas, A. Paetau, S. Kiuru-enari
Neuropathol Appl Neurobiol 31(6):589. [CrossRef]

Cerebrovascular P-glycoprotein expression is decreased in Creutzfeldt–Jakob disease
Silke Vogelgesang, Markus Glatzel, Lary C. Walker, Heyo K. Kroemer, Adriano Aguzzi, Rolf W. Warzok
Acta Neuropathol 111(5):436. [CrossRef]

Molecular determinants of Alzheimer?s disease A? peptide neurotoxicity
Roberto Cappai, Kevin J Barnham
Future Neurol 2(4):397. [CrossRef]

Peripherally expressed neprilysin reduces brain amyloid burden: A novel approach for treating Alzheimer's disease
Hanjun Guan, Yinxing Liu, Abigail Daily, Sara Police, Myung-Hee Kim, Salvatore Oddo, Frank M. Laferla, James R. Pauly, M. Paul Murphy, Louis B. Hersh
J Neurosci Res 87(6):1462. [CrossRef]

Effects of ginkgo biloba extract EGb761 on expression of RAGE and LRP-1 in cerebral microvascular endothelial cells under chronic hypoxia and hypoglycemia
Fu-Ling Yan, Ying Zheng, Feng-Di Zhao
Acta Neuropathol 116(5):529. [CrossRef]

Neuroprotective and neurotoxic properties of glial cells in the pathogenesis of Alzheimer's disease
D. Farfara, V. Lifshitz, D. Frenkel
J Cell Mol Med 12(3):762. [CrossRef]

A chemically modified preparation of alpha2-macroglobulin binds beta-amyloid peptide with increased affinity and inhibits Abeta cytotoxicity
Steven L. Gonias, Joseph M. Mettenburg, Sanja Arandjelovic
J Neurochem 93(1):53. [CrossRef]

Is the LDL Receptor Involved in Cortical Amyloid Protein Clearance?
Yasir Abdulkarim, Zeyad Hameed
Neurochem Res 31(6):839. [CrossRef]

Peripherally Administered Human Umbilical Cord Blood Cells Reduce Parenchymal and Vascular β-Amyloid Deposits in Alzheimer Mice
William V. Nikolic, Huayan Hou, Terrence Town, Yuyan Zhu, Brian Giunta, Cyndy D. Sanberg, Jin Zeng, Deyan Luo, Jared Ehrhart, Takashi Mori
Stem Cells and Devel 17(3):423. [CrossRef]

RAGE, LRP-1, and amyloid-beta protein in Alzheimer’s disease
John E. Donahue, Stephanie L. Flaherty, Conrad E. Johanson, John A. Duncan, Gerald D. Silverberg, Miles C. Miller, Rosemarie Tavares, Wentian Yang, Qian Wu, Edmond Sabo
Acta Neuropathol 112(4):405. [CrossRef]

Aβ is targeted to the vasculature in a mouse model of hereditary cerebral hemorrhage with amyloidosis
Martin C Herzig, David T Winkler, Patrick Burgermeister, Michelle Pfeifer, Esther Kohler, Stephen D Schmidt, Simone Danner, Dorothee Abramowski, Christine Stürchler-pierrat, Kurt Bürki
Nat Neurosci 7(9):954. [CrossRef]

Genetic-morphologic association study: association between the low density lipoprotein-receptor related protein (LRP) and cerebral amyloid angiopathy
M. Christoforidis, R. Schober, K. Krohn
Neuropathol Appl Neurobiol 31(1):11. [CrossRef]

Brain amyloid accumulates in aged rats with kaolin-induced hydrocephalus
Petra M. Klinge, Amir Samii, Sabine Niescken, Thomas Brinker, Gerald D. Silverberg
17(6):657. [CrossRef]

Clearing amyloid through the blood-brain barrier
Berislav V. Zlokovic
J Neurochem 89(4):807. [CrossRef]

Immunotherapy for Alzheimer's Disease and Other Dementias
Delphine Boche, James A.R. Nicoll, Roy O. Weller
Clin Neuropharmacol 29(1):22. [CrossRef]

APP Processing and the APP-KPI Domain Involvement in the Amyloid Cascade
M. Men&eacute;ndez-gonz&aacute;lez, P. P&eacute;rez-pinera, M. Mart&iacute;nez-rivera, M.T. Calatayud, B. Bl&aacute;zquez menes
Neurodegenerative Dis 2(6):277. [CrossRef]

Major Involvement of Low-Density Lipoprotein Receptor-Related Protein 1 in the Clearance of Plasma Free Amyloid β-Peptide by the Liver
Chihiro Tamaki, Sumio Ohtsuki, Takeshi Iwatsubo, Tadafumi Hashimoto, Kaoru Yamada, Chiori Yabuki, Tetsuya Terasaki
Pharmaceutical Research (Dordrecht) 23(7):1407. [CrossRef]

Soluble Arctic amyloid beta protein inhibits hippocampal long-term potentiation in vivo
Igor Klyubin, Dominic M. Walsh, William K. Cullen, Julia V. Fadeeva, Roger Anwyl, Dennis J. Selkoe, Michael J. Rowan
Eur J Neurosci 19(10):2839. [CrossRef]

Capillary and arterial cerebral amyloid angiopathy in Alzheimer's disease: defining the perivascular route for the elimination of amyloid beta from the human brain
S. D. Preston, P. V. Steart, A. Wilkinson, J. A. R. Nicoll, R. O. Weller
Neuropathol Appl Neurobiol 29(2):106. [CrossRef]

Novel ventriculo-peritoneal shunt in Alzheimer's disease cerebrospinal fluid biomarkers
Gerald D Silverberg, Martha Mayo, Thomas Saul, Joan Carvalho, Dawn Mcguire
Expert Rev Neurotherapeutics 4(1):97. [CrossRef]

Vaccines for conformational disorders
Marcin Sadowski, Thomas Wisniewski
Expert Rev Vaccines 3(3):279. [CrossRef]

ApoE −491A/T Promoter Polymorphism is not an Independent Risk Factor, but Associated with the ε4 Allele in Hungarian Alzheimer’s Dementia Population
Anna Juhász, András Palotás, Zoltán Janka, Ágnes Rimanóczy, Miklós Palotás, Nikoletta Bódi, Krisztina Boda, Marianna Zana, Gábor Vincze, János Kálmán
Neurochem Res 30(5):591. [CrossRef]

Immunotherapy for Alzheimer??s disease and other dementias
Delphine Boche, James AR Nicoll, Roy O Weller
Curr Opin Neurol 18(6):720???725. [CrossRef]

Transport pathways for clearance of human Alzheimer's amyloid β-peptide and apolipoproteins E and J in the mouse central nervous system
Robert D Bell, Abhay P Sagare, Alan E Friedman, Gurrinder S Bedi, David M Holtzman, Rashid Deane, Berislav V Zlokovic
J Cereb Blood Flow Metab [CrossRef]

Role of the MEOX2 homeobox gene in neurovascular dysfunction in Alzheimer disease
Zhenhua Wu, Huang Guo, Nienwen Chow, Jan Sallstrom, Robert D Bell, Rashid Deane, Andrew I Brooks, Suhasini Kanagala, Anna Rubio, Abhay Sagare
Nat Med [CrossRef]

Mechanisms of Disease: The Blood-Brain Barrier
Edward A. Neuwelt
Neurosurg [CrossRef]

Safety, Tolerability, and Changes in Amyloid ?? Concentrations After Administration of a ??-Secretase Inhibitor in Volunteers
Eric Siemers, Michael Skinner, Robert A Dean, Celedon Gonzales, Julie Satterwhite, Martin Farlow, Daniel Ness, Patrick C May
Clin Neuropharmacol 28(3):126. [CrossRef]

Kinetic Analysis of Aggregated Amyloid-β Peptide Clearance in Adult Bone-marrow-derived Macrophages from APP and CCL2 Transgenic Mice
Masaru Yamamoto, Tomomi Kiyota, Shannon M. Walsh, Tsuneya Ikezu
Jrnl NeuroImmune Pharm 2(2):213. [CrossRef]

Assessment of the Bioactivity of Antibodies against &beta;-Amyloid Peptide in vitro and in vivo
M. Hasan Mohajeri, Meret N.M. Gaugler, Julia Martinez, Jay Tracy, Hong Li, Arames Crameri, Katrin Kuehnle, M. Axel Wollmer, Roger M. Nitsch
Neurodegenerative Dis 1(4-5):160. [CrossRef]

Role of apoE in conformation-prone diseases and atherosclerosis
A. D. Dergunov
Biochemistry Moscow 71(7):707. [CrossRef]

Maximizing the Potential of Plasma Amyloid-Beta as a Diagnostic Biomarker for Alzheimer’s Disease
Esther S. Oh, Juan C. Troncoso, Stina M. Fangmark tucker
NMM 10(3):195. [CrossRef]

Mechanism of Cerebral β-Amyloid Angiopathy: Murine and Cellular Models
Martin C. Herzig, William E. Nostrand, Mathias Jucker
Brain Pathol 16(1):40. [CrossRef]

Lipid metabolism in Alzheimers and Parkinsons disease
Qin Xu, Yadong Huang
Future Lipidol 1(4):441. [CrossRef]

Blood-Brain Barrier Permeability Correlates with Medial Temporal Lobe Atrophy but Not with Amyloid-&beta; Protein Transport across the Blood-Brain Barrier in Alzheimer&rsquo;s Disease
Yasuko Matsumoto, Daisuke Yanase, Moeko Noguchi-shinohara, Kenjiro Ono, Mitsuhiro Yoshita, Masahito Yamada
Dementia Geriatr Cognit Disord 23(4):241. [CrossRef]

Antibody-based approaches in Alzheimer’s research: safety, pharmacokinetics, metabolism, and analytical tools
Peter Lichtlen, M. Hasan Mohajeri
J Neurochem 104(4):859. [CrossRef]

Possible Involvement of ER Chaperone Grp78 on Reduced Formation of Amyloid-β Deposits
J. Kakimura, Y. Kitamura, K. Takata, D. Tsuchiya, T. Taniguchi, P. J. Gebicke-haerter, M. A. Smith, G. Perry, S. Shimohama
Ann N Y Acad Sci 977(1):327. [CrossRef]

Cholesterol metabolism, apolipoprotein E, adenosine triphosphate-binding cassette transporters, and Alzheimer??s disease
Veronica Hirsch-reinshagen, Cheryl L Wellington
Curr Opin Lipidol 18(3):325???332. [CrossRef]

Immunization treatment approaches in Alzheimer’s and prion diseases
Thomas Wisniewski, Einar M. Sigurdsson
Curr Neurol Neurosci Rep 2(5):400. [CrossRef]

Therapeutic approaches for prion and Alzheimer's diseases
Thomas Wisniewski, Einar M. Sigurdsson
FEBS J 274(15):3784. [CrossRef]

Clearance of amyloid-β by circulating lipoprotein receptors
Abhay Sagare, Rashid Deane, Robert D Bell, Bradley Johnson, Katie Hamm, Ronan Pendu, Andrew Marky, Peter J Lenting, Zhenhua Wu, Troy Zarcone
Nat Med 13(9):1029. [CrossRef]

Identification of a β-amyloid-binding plasma protein, LRP1: implications for biomarker research and therapy in Alzheimer’s disease
Henrik Zetterberg
Biomarkers Med 1(3):347. [CrossRef]

Heat Shock Proteins and Amateur Chaperones in Amyloid-Beta Accumulation and Clearance in Alzheimer’s Disease
Micha M. M. Wilhelmus, Robert M. W. Waal, Marcel M. Verbeek
MN 35(3):203. [CrossRef]

Macrophage colony stimulating factor is associated with excretion of amyloid-β peptides from cerebrospinal fluid to peripheral blood
Jingwei Jiang, Masayasu Okochi, Shinji Tagami, Kouhei Nishitomi, Kanta Yanagida, Taisuke Nakayama, Shin-ichi Tatsumi, Kohji Mori, Masatoshi Takeda
8(4):188. [CrossRef]

Possible role of scavenger receptor SRCL in the clearance of amyloid-βin Alzheimer's disease
Kenji Nakamura, Wakana Ohya, Hiroshi Funakoshi, Gaku Sakaguchi, Akira Kato, Masatoshi Takeda, Takashi Kudo, Toshikazu Nakamura
J Neurosci Res 84(4):874. [CrossRef]

apoE isoform–specific disruption of amyloid β peptide clearance from mouse brain
Rashid Deane, Abhay Sagare, Katie Hamm, Margaret Parisi, Steven Lane, Mary Beth Finn, David M. Holtzman, Berislav V. Zlokovic
J Clin Invest 118(12):4002. [CrossRef]

LRP1 and cerebral amyloid angiopathy
Takahisa Kanekiyo, Guojun Bu
Future Neurol 4(1):55. [CrossRef]

Consequence of A  immunization on the vasculature of human Alzheimer's disease brain
D. Boche, E. Zotova, R. O. Weller, S. Love, J. W. Neal, R. M. Pickering, D. Wilkinson, C. Holmes, J. A. R. Nicoll
131(12):3299. [CrossRef]

SRF and myocardin regulate LRP-mediated amyloid-β clearance in brain vascular cells
Robert D. Bell, Rashid Deane, Nienwen Chow, Xiaochun Long, Abhay Sagare, Itender Singh, Jeffrey W. Streb, Huang Guo, Anna Rubio, William Van nostrand
Nat Cell Biol 11(2):143. [CrossRef]

Alzheimer's dementia by circulation disorders: when trees hide the forest
Carlos G. Dotti, Bart De Strooper
Nat Cell Biol 11(2):114. [CrossRef]

Microvasculature changes and cerebral amyloid angiopathy in Alzheimer’s disease and their potential impact on therapy
Roy O. Weller, Delphine Boche, James A. R. Nicoll
Acta Neuropathol 118(1):87. [CrossRef]

Plaque-Associated Overexpression of Insulin-Degrading Enzyme in the Cerebral Cortex of Aged Transgenic Tg2576 Mice With Alzheimer Pathology
María C. Leal, Verónica B. Dorfman, Agata Fernández Gamba, Blas Frangione, Thomas Wisniewski, Eduardo M. Castaño, Einar M. Sigurdsson, Laura Morelli
Neuropathol Exp Neurol 65(10):976. [CrossRef]

Safety, Tolerability, and Effects on Plasma and Cerebrospinal Fluid Amyloid-β After Inhibition of γ-Secretase
Eric R. Siemers, Robert A. Dean, Stuart Friedrich, Lisa Ferguson-sells, Celedon Gonzales, Martin R. Farlow, Patrick C. May
Clin Neuropharmacol 30(6):317. [CrossRef]

Upregulation of RAGE at the blood-brain barrier in streptozotocin-induced diabetic mice
Li Ping Liu, Hao Hong, Jian Ming Liao, Tong Sheng Wang, Jing Wu, Si Si Chen, Yong Qi Li, Yan Long, Yuan Zheng Xia
Synapse (Hoboken) 63(8):636. [CrossRef]

Apolipoprotein E and its receptors in Alzheimer's disease: pathways, pathogenesis and therapy
Guojun Bu
Nat Rev Neurosci 10(5):333. [CrossRef]

Clearance mechanisms of Alzheimer's amyloid-β peptide: implications for therapeutic design and diagnostic tests
K A Bates, G Verdile, Q-X Li, D Ames, P Hudson, C L Masters, R N Martins
Mol Psychiatry 14(5):469. [CrossRef]